Gene/Proteome Database (LMPD)
Proteins
protein preY, mitochondrial | |
---|---|
Refseq ID | NP_001248497 |
Protein GI | 387849251 |
UniProt ID | F6RHL0 |
mRNA ID | NM_001261568 |
Length | 114 |
Protein sequence is identical to GI:109074967 (mRNA isoform) |
Refseq ID | XP_001100687 |
Protein GI | 109074967 |
UniProt ID | F6RHL0 |
mRNA ID | XM_001100687 |
Length | 114 |
MLSGARGRLASALRGTSAARSAVACRCLHASGSRPLADRSNKTEEPPRALDPALLEFLVCPLSKKPLRYEASTNELINEELGIAYPIIDGIPNMIPQAARMTHQSKKQEEVEQR |
Gene Information
Entrez Gene ID
Gene Name
PIGY upstream reading frame
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005789 | IEA:Ensembl | C | endoplasmic reticulum membrane |
GO:0000506 | IEA:Ensembl | C | glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex |
GO:0005739 | IEA:Ensembl | C | mitochondrion |
GO:0006506 | IEA:Ensembl | P | GPI anchor biosynthetic process |
GO:0009893 | IEA:Ensembl | P | positive regulation of metabolic process |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR005651 | Uncharacterised protein family UPF0434/Trm112 |
UniProt Annotations
Entry Information
Gene Name
PIGY upstream reading frame
Protein Entry
F6RHL0_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014745 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109074967 | RefSeq | XP_001100687 | 114 | PIGY upstream reading frame |
Identical Sequences to LMP014745 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:387849251 | GenBank | EHH53835.1 | 114 | Protein preY, mitochondrial [Macaca fascicularis] |
GI:387849251 | GenBank | AFI33577.1 | 114 | protein preY, mitochondrial isoform 1 [Macaca mulatta] |
GI:387849251 | RefSeq | XP_005555452.1 | 114 | PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit Y-like isoform X1 [Macaca fascicularis] |
Related Sequences to LMP014745 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:387849251 | GenBank | AFH30100.1 | 114 | protein preY, mitochondrial isoform 1 [Macaca mulatta] |