Gene/Proteome Database (LMPD)

LMPD ID
LMP014745
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
PIGY upstream reading frame
Gene Symbol
Alternate Names
protein preY, mitochondrial;
Chromosome
5
Map Location
chromosome:5

Proteins

protein preY, mitochondrial
Refseq ID NP_001248497
Protein GI 387849251
UniProt ID F6RHL0
mRNA ID NM_001261568
Length 114
Protein sequence is identical to GI:109074967 (mRNA isoform)
Refseq ID XP_001100687
Protein GI 109074967
UniProt ID F6RHL0
mRNA ID XM_001100687
Length 114
MLSGARGRLASALRGTSAARSAVACRCLHASGSRPLADRSNKTEEPPRALDPALLEFLVCPLSKKPLRYEASTNELINEELGIAYPIIDGIPNMIPQAARMTHQSKKQEEVEQR

Gene Information

Entrez Gene ID
Gene Name
PIGY upstream reading frame
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005789 IEA:Ensembl C endoplasmic reticulum membrane
GO:0000506 IEA:Ensembl C glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex
GO:0005739 IEA:Ensembl C mitochondrion
GO:0006506 IEA:Ensembl P GPI anchor biosynthetic process
GO:0009893 IEA:Ensembl P positive regulation of metabolic process

Domain Information

InterPro Annotations

Accession Description
IPR005651 Uncharacterised protein family UPF0434/Trm112

UniProt Annotations

Entry Information

Gene Name
PIGY upstream reading frame
Protein Entry
F6RHL0_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014745 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109074967 RefSeq XP_001100687 114 PIGY upstream reading frame

Identical Sequences to LMP014745 proteins

Reference Database Accession Length Protein Name
GI:387849251 GenBank EHH53835.1 114 Protein preY, mitochondrial [Macaca fascicularis]
GI:387849251 GenBank AFI33577.1 114 protein preY, mitochondrial isoform 1 [Macaca mulatta]
GI:387849251 RefSeq XP_005555452.1 114 PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit Y-like isoform X1 [Macaca fascicularis]

Related Sequences to LMP014745 proteins

Reference Database Accession Length Protein Name
GI:387849251 GenBank AFH30100.1 114 protein preY, mitochondrial isoform 1 [Macaca mulatta]