Gene/Proteome Database (LMPD)

LMPD ID
LMP014752
Gene ID
699532
Species
Macaca mulatta (Rhesus monkey)
Gene Name
retinoic acid receptor, gamma
Gene Symbol
RARG
Alternate Names
retinoic acid receptor, gamma; Retinoic acid receptor gamma;
Chromosome
11
Map Location
chromosome:11

Proteins

Refseq ID XP_001087992
Protein GI 297262495
UniProt ID F6RB79
mRNA ID XM_001087992
Length 454
MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA
Refseq ID XP_002798647
Protein GI 297262493
UniProt ID F6RB60
mRNA ID XM_001087992
Length 443
MYDCMETFSPGPRRLYGAAGPGTGLLRRATGGSCFAGLESFAWPQPTSLQSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA

Gene Information

Entrez Gene ID
699532
Gene Name
retinoic acid receptor, gamma
Gene Symbol
RARG
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0000790 IEA:Ensembl C nuclear chromatin
GO:0005667 IEA:Ensembl C transcription factor complex
GO:0000977 IEA:Ensembl F RNA polymerase II regulatory region sequence-specific DNA binding
GO:0003708 IEA:InterPro F retinoic acid receptor activity
GO:0003707 IEA:InterPro F steroid hormone receptor activity
GO:0008270 IEA:InterPro F zinc ion binding
GO:0070384 IEA:Ensembl P Harderian gland development
GO:0009952 IEA:Ensembl P anterior/posterior pattern specification
GO:0071300 IEA:Ensembl P cellular response to retinoic acid
GO:0031076 IEA:Ensembl P embryonic camera-type eye development
GO:0048048 IEA:Ensembl P embryonic eye morphogenesis
GO:0035116 IEA:Ensembl P embryonic hindlimb morphogenesis
GO:0060324 IEA:Ensembl P face development
GO:0002068 IEA:Ensembl P glandular epithelial cell development
GO:0003430 IEA:Ensembl P growth plate cartilage chondrocyte growth
GO:0035264 IEA:Ensembl P multicellular organism growth
GO:0043066 IEA:Ensembl P negative regulation of apoptotic process
GO:0061037 IEA:Ensembl P negative regulation of cartilage development
GO:0008285 IEA:Ensembl P negative regulation of cell proliferation
GO:0032331 IEA:Ensembl P negative regulation of chondrocyte differentiation
GO:0000122 IEA:Ensembl P negative regulation of transcription from RNA polymerase II promoter
GO:0001843 IEA:Ensembl P neural tube closure
GO:0043065 IEA:Ensembl P positive regulation of apoptotic process
GO:0008284 IEA:Ensembl P positive regulation of cell proliferation
GO:0045944 IEA:Ensembl P positive regulation of transcription from RNA polymerase II promoter
GO:0060740 IEA:Ensembl P prostate gland epithelium morphogenesis
GO:0003406 IEA:Ensembl P retinal pigment epithelium development
GO:0060534 IEA:Ensembl P trachea cartilage development

Domain Information

InterPro Annotations

Accession Description
IPR008946 Nuclear hormone receptor, ligand-binding
IPR000536 Nuclear hormone receptor, ligand-binding, core
IPR003078 Retinoic acid receptor
IPR001723 Steroid hormone receptor
IPR013088 Zinc finger, NHR/GATA-type
IPR001628 Zinc finger, nuclear hormone receptor-type

UniProt Annotations

Entry Information

Gene Name
retinoic acid receptor, gamma
Protein Entry
F6RB79_MACMU
UniProt ID
F6RB79
Species
Rhesus monkey

Comments

Comment Type Description
Similarity Belongs to the nuclear hormone receptor family.
Similarity Contains nuclear receptor DNA-binding domain.

Identical and Related Proteins

Unique RefSeq proteins for LMP014752 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
297262495 RefSeq XP_001087992 454 retinoic acid receptor, gamma
297262493 RefSeq XP_002798647 443 retinoic acid receptor, gamma

Identical Sequences to LMP014752 proteins

Reference Database Accession Length Protein Name
GI:297262493 RefSeq XP_003906499.1 443 PREDICTED: retinoic acid receptor gamma isoform X4 [Papio anubis]
GI:297262493 RefSeq XP_005571046.1 443 PREDICTED: retinoic acid receptor gamma isoform X3 [Macaca fascicularis]
GI:297262495 RefSeq XP_009423601.1 454 PREDICTED: retinoic acid receptor gamma isoform X2 [Pan troglodytes]
GI:297262495 RefSeq XP_009423602.1 454 PREDICTED: retinoic acid receptor gamma isoform X2 [Pan troglodytes]
GI:297262495 RefSeq XP_009423603.1 454 PREDICTED: retinoic acid receptor gamma isoform X2 [Pan troglodytes]
GI:297262495 RefSeq XP_009423604.1 454 PREDICTED: retinoic acid receptor gamma isoform X2 [Pan troglodytes]

Related Sequences to LMP014752 proteins

Reference Database Accession Length Protein Name
GI:297262493 DBBJ BAI45667.1 454 retinoic acid receptor, gamma, partial [synthetic construct]
GI:297262493 RefSeq NP_001036193.1 443 retinoic acid receptor gamma isoform 2 [Homo sapiens]
GI:297262493 RefSeq XP_001087992.2 454 PREDICTED: retinoic acid receptor gamma isoform 1 [Macaca mulatta]
GI:297262493 RefSeq XP_008001592.1 454 PREDICTED: retinoic acid receptor gamma isoform X3 [Chlorocebus sabaeus]