Gene/Proteome Database (LMPD)

LMPD ID
LMP014756
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
retinol binding protein 2, cellular
Gene Symbol
Alternate Names
retinol-binding protein 2;
Chromosome
2
Map Location
chromosome:2

Proteins

retinol-binding protein 2
Refseq ID NP_001181528
Protein GI 302564121
UniProt ID F6VER9
mRNA ID NM_001194599
Length 134
Protein sequence is identical to GI:109049083 (mRNA isoform)
Refseq ID XP_001113494
Protein GI 109049083
UniProt ID F6VER9
mRNA ID XM_001113494
Length 134
MTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVHLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKGLDNRHVKSLVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGNQVCRQVFKKK

Gene Information

Entrez Gene ID
Gene Name
retinol binding protein 2, cellular
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0008289 IEA:InterPro F lipid binding
GO:0005215 IEA:InterPro F transporter activity

KEGG Pathway Links

KEGG Pathway ID Description
ko04977 Vitamin digestion and absorption
mcc04977 Vitamin digestion and absorption

Domain Information

InterPro Annotations

Accession Description
IPR012674 Calycin
IPR011038 Calycin-like
IPR000463 Cytosolic fatty-acid binding
IPR000566 Lipocalin/cytosolic fatty-acid binding domain

UniProt Annotations

Entry Information

Gene Name
retinol binding protein 2, cellular
Protein Entry
F6VER9_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014756 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109049083 RefSeq XP_001113494 134 retinol binding protein 2, cellular

Identical Sequences to LMP014756 proteins

Reference Database Accession Length Protein Name
GI:302564121 GenBank EHH16721.1 134 hypothetical protein EGK_12053 [Macaca mulatta]
GI:302564121 GenBank EHH51633.1 134 hypothetical protein EGM_11048 [Macaca fascicularis]
GI:302564121 RefSeq XP_005545975.1 134 PREDICTED: retinol-binding protein 2 [Macaca fascicularis]

Related Sequences to LMP014756 proteins

Reference Database Accession Length Protein Name
GI:302564121 RefSeq XP_010354884.1 134 PREDICTED: retinol-binding protein 2 [Rhinopithecus roxellana]