Gene/Proteome Database (LMPD)
Proteins
retinol-binding protein 2 | |
---|---|
Refseq ID | NP_001181528 |
Protein GI | 302564121 |
UniProt ID | F6VER9 |
mRNA ID | NM_001194599 |
Length | 134 |
Protein sequence is identical to GI:109049083 (mRNA isoform) |
Refseq ID | XP_001113494 |
Protein GI | 109049083 |
UniProt ID | F6VER9 |
mRNA ID | XM_001113494 |
Length | 134 |
MTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVHLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKGLDNRHVKSLVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGNQVCRQVFKKK |
Gene Information
Entrez Gene ID
Gene Name
retinol binding protein 2, cellular
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0008289 | IEA:InterPro | F | lipid binding |
GO:0005215 | IEA:InterPro | F | transporter activity |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
retinol binding protein 2, cellular
Protein Entry
F6VER9_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014756 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109049083 | RefSeq | XP_001113494 | 134 | retinol binding protein 2, cellular |
Identical Sequences to LMP014756 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:302564121 | GenBank | EHH16721.1 | 134 | hypothetical protein EGK_12053 [Macaca mulatta] |
GI:302564121 | GenBank | EHH51633.1 | 134 | hypothetical protein EGM_11048 [Macaca fascicularis] |
GI:302564121 | RefSeq | XP_005545975.1 | 134 | PREDICTED: retinol-binding protein 2 [Macaca fascicularis] |
Related Sequences to LMP014756 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:302564121 | RefSeq | XP_010354884.1 | 134 | PREDICTED: retinol-binding protein 2 [Rhinopithecus roxellana] |