Gene/Proteome Database (LMPD)
LMPD ID
LMP014898
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
serine palmitoyltransferase, small subunit A
Gene Symbol
Synonyms
C14orf147; C7H14orf147;
Alternate Names
serine palmitoyltransferase, small subunit A; small subunit of serine palmitoyltransferase A;
Chromosome
7
Map Location
chromosome:7
Proteins
| serine palmitoyltransferase, small subunit A | |
|---|---|
| Refseq ID | NP_001180275 |
| Protein GI | 301069376 |
| UniProt ID | H9FQR5 |
| mRNA ID | NM_001193346 |
| Length | 71 |
| Protein sequence is identical to GI:109083275 (mRNA isoform) | |
| Refseq ID | XP_001115197 |
| Protein GI | 109083275 |
| UniProt ID | H9FQR5 |
| mRNA ID | XM_001115197 |
| Length | 71 |
| MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSIVGMALYTGYVFMPQHIMAILHYFEIVQ | |
Gene Information
Entrez Gene ID
Gene Name
serine palmitoyltransferase, small subunit A
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0017059 | IEA:Ensembl | C | serine C-palmitoyltransferase complex |
| GO:0004758 | IEA:Ensembl | F | serine C-palmitoyltransferase activity |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR024512 | Small subunit of serine palmitoyltransferase-like |
UniProt Annotations
Entry Information
Gene Name
serine palmitoyltransferase, small subunit A
Protein Entry
H9FQR5_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014898 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109083275 | RefSeq | XP_001115197 | 71 | serine palmitoyltransferase, small subunit A |
Identical Sequences to LMP014898 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:301069376 | RefSeq | XP_005561110.1 | 71 | PREDICTED: serine palmitoyltransferase small subunit A [Macaca fascicularis] |
| GI:301069376 | RefSeq | XP_007984647.1 | 71 | PREDICTED: serine palmitoyltransferase small subunit A [Chlorocebus sabaeus] |
| GI:301069376 | RefSeq | XP_010370561.1 | 71 | PREDICTED: serine palmitoyltransferase small subunit A [Rhinopithecus roxellana] |
| GI:301069376 | RefSeq | XP_010333257.1 | 71 | PREDICTED: serine palmitoyltransferase small subunit A [Saimiri boliviensis boliviensis] |
Related Sequences to LMP014898 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:301069376 | EMBL | CAF16561.1 | 71 | unnamed protein product, partial [Homo sapiens] |
| GI:301069376 | EMBL | CAF16563.1 | 71 | unnamed protein product, partial [Homo sapiens] |
| GI:301069376 | GenBank | AAR73573.1 | 71 | Sequence 6118 from patent US 6639063 |
| GI:301069376 | SwissProt | Q969W0.2 | 71 | RecName: Full=Serine palmitoyltransferase small subunit A; AltName: Full=Small subunit of serine palmitoyltransferase A; Short=ssSPTa [Homo sapiens] |