Gene/Proteome Database (LMPD)
LMPD ID
LMP014899
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
serine palmitoyltransferase, small subunit B
Gene Symbol
Synonyms
C3orf57; C2H3orf57;
Alternate Names
serine palmitoyltransferase, small subunit B; serine palmitoyltransferase small subunit B; small subunit of serine palmitoyltransferase B;
Chromosome
2
Map Location
chromosome:2
Proteins
| serine palmitoyltransferase, small subunit B | |
|---|---|
| Refseq ID | NP_001180283 |
| Protein GI | 301069403 |
| UniProt ID | F6X5J4 |
| mRNA ID | NM_001193354 |
| Length | 76 |
| Protein sequence is identical to GI:297286490 (mRNA isoform) | |
| Refseq ID | XP_002802980 |
| Protein GI | 297286490 |
| UniProt ID | F6X5J4 |
| mRNA ID | XM_002802934 |
| Length | 76 |
| MDLRRVKEYFSWLYYQYQIISCCAVLEPWERSMFNTILLTIIAMVVYTAYVFIPIHIRLAWEFFSKICGYHSTISN | |
Gene Information
Entrez Gene ID
Gene Name
serine palmitoyltransferase, small subunit B
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0017059 | IEA:Ensembl | C | serine C-palmitoyltransferase complex |
| GO:0004758 | IEA:Ensembl | F | serine C-palmitoyltransferase activity |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR024512 | Small subunit of serine palmitoyltransferase-like |
UniProt Annotations
Entry Information
Gene Name
serine palmitoyltransferase, small subunit B
Protein Entry
F6X5J4_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014899 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 297286490 | RefSeq | XP_002802980 | 76 | serine palmitoyltransferase, small subunit B |
Identical Sequences to LMP014899 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:301069403 | RefSeq | XP_008954300.1 | 76 | PREDICTED: serine palmitoyltransferase small subunit B [Pan paniscus] |
| GI:301069403 | RefSeq | XP_009199684.1 | 76 | PREDICTED: serine palmitoyltransferase small subunit B [Papio anubis] |
| GI:301069403 | RefSeq | XP_009237768.1 | 76 | PREDICTED: serine palmitoyltransferase small subunit B [Pongo abelii] |
| GI:301069403 | RefSeq | XP_010334007.1 | 76 | PREDICTED: serine palmitoyltransferase small subunit B [Saimiri boliviensis boliviensis] |
Related Sequences to LMP014899 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:301069403 | GenBank | AAM49720.1 | 76 | ADMP [Homo sapiens] |
| GI:301069403 | RefSeq | XP_004089712.1 | 76 | PREDICTED: serine palmitoyltransferase small subunit B [Nomascus leucogenys] |
| GI:301069403 | RefSeq | XP_008006709.1 | 76 | PREDICTED: serine palmitoyltransferase small subunit B [Chlorocebus sabaeus] |