Gene/Proteome Database (LMPD)
LMPD ID
LMP014903
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
Gene Symbol
Alternate Names
steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2);
Chromosome
13
Map Location
chromosome:13
Proteins
Refseq ID | XP_001105329 |
Protein GI | 109102574 |
UniProt ID | F6QL58 |
mRNA ID | XM_001105329 |
Length | 254 |
MQVQCQQSPVLAGSATLVALGALVLYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSLFGPPGTVLLGLFCVHYFHRTFVYSLLNRGRPYPAVLIFRGIAFCAGNGFLQSYYLIYCAEYPDGWYTDIRFCLGVFLFILGMGVNIHSDYILRQLRKPGEITYRIPQGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSVCFLGLRAFHHHRFYLKMFEDYPKSRKALIPFIF |
Gene Information
Entrez Gene ID
Gene Name
steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005737 | IEA:InterPro | C | cytoplasm |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0003865 | IEA:Ensembl | F | 3-oxo-5-alpha-steroid 4-dehydrogenase activity |
GO:0006702 | IEA:Ensembl | P | androgen biosynthetic process |
GO:0030539 | IEA:Ensembl | P | male genitalia development |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
Protein Entry
F6QL58_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014903 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109102574 | RefSeq | XP_001105329 | 254 | steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2) |
Identical Sequences to LMP014903 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP014903 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109102574 | GenBank | AAB34213.1 | 254 | steroid 5 alpha-reductase type 2 isoenzyme [Macaca fascicularis] |
GI:109102574 | RefSeq | NP_001270396.1 | 254 | 3-oxo-5-alpha-steroid 4-dehydrogenase 2 [Macaca fascicularis] |
GI:109102574 | RefSeq | XP_007969218.1 | 284 | PREDICTED: 3-oxo-5-alpha-steroid 4-dehydrogenase 2 [Chlorocebus sabaeus] |
GI:109102574 | SwissProt | Q28892.1 | 254 | RecName: Full=3-oxo-5-alpha-steroid 4-dehydrogenase 2; AltName: Full=5 alpha-SR2; AltName: Full=SR type 2; AltName: Full=Steroid 5-alpha-reductase 2; Short=S5AR 2 [Macaca fascicularis] |