Gene/Proteome Database (LMPD)

LMPD ID
LMP014903
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
Gene Symbol
Alternate Names
steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2);
Chromosome
13
Map Location
chromosome:13

Proteins

Refseq ID XP_001105329
Protein GI 109102574
UniProt ID F6QL58
mRNA ID XM_001105329
Length 254
MQVQCQQSPVLAGSATLVALGALVLYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSLFGPPGTVLLGLFCVHYFHRTFVYSLLNRGRPYPAVLIFRGIAFCAGNGFLQSYYLIYCAEYPDGWYTDIRFCLGVFLFILGMGVNIHSDYILRQLRKPGEITYRIPQGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSVCFLGLRAFHHHRFYLKMFEDYPKSRKALIPFIF

Gene Information

Entrez Gene ID
Gene Name
steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:InterPro C cytoplasm
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0003865 IEA:Ensembl F 3-oxo-5-alpha-steroid 4-dehydrogenase activity
GO:0006702 IEA:Ensembl P androgen biosynthetic process
GO:0030539 IEA:Ensembl P male genitalia development

KEGG Pathway Links

KEGG Pathway ID Description
ko05215 Prostate cancer
mcc05215 Prostate cancer
ko00140 Steroid hormone biosynthesis
mcc00140 Steroid hormone biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR016636 3-oxo-5-alpha-steroid 4-dehydrogenase
IPR001104 3-oxo-5-alpha-steroid 4-dehydrogenase, C-terminal

UniProt Annotations

Entry Information

Gene Name
steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
Protein Entry
F6QL58_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014903 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109102574 RefSeq XP_001105329 254 steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)

Identical Sequences to LMP014903 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP014903 proteins

Reference Database Accession Length Protein Name
GI:109102574 GenBank AAB34213.1 254 steroid 5 alpha-reductase type 2 isoenzyme [Macaca fascicularis]
GI:109102574 RefSeq NP_001270396.1 254 3-oxo-5-alpha-steroid 4-dehydrogenase 2 [Macaca fascicularis]
GI:109102574 RefSeq XP_007969218.1 284 PREDICTED: 3-oxo-5-alpha-steroid 4-dehydrogenase 2 [Chlorocebus sabaeus]
GI:109102574 SwissProt Q28892.1 254 RecName: Full=3-oxo-5-alpha-steroid 4-dehydrogenase 2; AltName: Full=5 alpha-SR2; AltName: Full=SR type 2; AltName: Full=Steroid 5-alpha-reductase 2; Short=S5AR 2 [Macaca fascicularis]