Gene/Proteome Database (LMPD)
Proteins
probable polyprenol reductase | |
---|---|
Refseq ID | NP_001244878 |
Protein GI | 383872832 |
UniProt ID | F6R6P8 |
mRNA ID | NM_001257949 |
Length | 318 |
Protein sequence is identical to GI:109074803 (mRNA isoform) |
Refseq ID | XP_001088853 |
Protein GI | 109074803 |
UniProt ID | F6R6P8 |
mRNA ID | XM_001088853 |
Length | 318 |
MAPWAEAELSALNPLRAVWLTLTAAFLLTLLLQLLPPGLLPGCAIFQDLIRYGKTKCGEPPRPAACRAFDVPKRYFSHFYIISVLWNGFLLWCLSQSLFLGAPFPSWLHGLLRILGAAQFQGGELALSAFLVLVFLWLHSIRRLFECLYVSVFSNVMIHVVQYCFGLVYYVLVGLTVLSQVPMDGRNAYVTGKNVLMQARWFHILGMMMFIWSSAHQYKCHVILGNLRKNKAGVVIHCNHRIPFGDWFEYVSSPNYLAELMIYVSMAVTFGFHNFTWWLVVTNVFFSQALSAFLSHQFYKSKFVSYPKHRKAFLPFLF |
Gene Information
Entrez Gene ID
Gene Name
steroid 5 alpha-reductase 3
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:Ensembl | C | endoplasmic reticulum |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0003865 | IEA:Ensembl | F | 3-oxo-5-alpha-steroid 4-dehydrogenase activity |
GO:0016628 | IEA:Ensembl | F | oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor |
GO:0019348 | IEA:Ensembl | P | dolichol metabolic process |
GO:0006488 | IEA:Ensembl | P | dolichol-linked oligosaccharide biosynthetic process |
GO:0016095 | IEA:Ensembl | P | polyprenol catabolic process |
KEGG Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR001104 | 3-oxo-5-alpha-steroid 4-dehydrogenase, C-terminal |
UniProt Annotations
Entry Information
Gene Name
steroid 5 alpha-reductase 3
Protein Entry
F6R6P8_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014904 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109074803 | RefSeq | XP_001088853 | 318 | steroid 5 alpha-reductase 3 |
Identical Sequences to LMP014904 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:383872832 | GenBank | AFE66544.1 | 318 | putative polyprenol reductase [Macaca mulatta] |
Related Sequences to LMP014904 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:383872832 | RefSeq | XP_003898926.1 | 318 | PREDICTED: polyprenol reductase [Papio anubis] |
GI:383872832 | RefSeq | XP_005555326.1 | 318 | PREDICTED: polyprenol reductase [Macaca fascicularis] |
GI:383872832 | RefSeq | XP_007996877.1 | 318 | PREDICTED: polyprenol reductase [Chlorocebus sabaeus] |