Gene/Proteome Database (LMPD)

LMPD ID
LMP014904
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
steroid 5 alpha-reductase 3
Gene Symbol
Alternate Names
probable polyprenol reductase; putative polyprenol reductase;
Chromosome
5
Map Location
chromosome:5

Proteins

probable polyprenol reductase
Refseq ID NP_001244878
Protein GI 383872832
UniProt ID F6R6P8
mRNA ID NM_001257949
Length 318
Protein sequence is identical to GI:109074803 (mRNA isoform)
Refseq ID XP_001088853
Protein GI 109074803
UniProt ID F6R6P8
mRNA ID XM_001088853
Length 318
MAPWAEAELSALNPLRAVWLTLTAAFLLTLLLQLLPPGLLPGCAIFQDLIRYGKTKCGEPPRPAACRAFDVPKRYFSHFYIISVLWNGFLLWCLSQSLFLGAPFPSWLHGLLRILGAAQFQGGELALSAFLVLVFLWLHSIRRLFECLYVSVFSNVMIHVVQYCFGLVYYVLVGLTVLSQVPMDGRNAYVTGKNVLMQARWFHILGMMMFIWSSAHQYKCHVILGNLRKNKAGVVIHCNHRIPFGDWFEYVSSPNYLAELMIYVSMAVTFGFHNFTWWLVVTNVFFSQALSAFLSHQFYKSKFVSYPKHRKAFLPFLF

Gene Information

Entrez Gene ID
Gene Name
steroid 5 alpha-reductase 3
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:Ensembl C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0003865 IEA:Ensembl F 3-oxo-5-alpha-steroid 4-dehydrogenase activity
GO:0016628 IEA:Ensembl F oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor
GO:0019348 IEA:Ensembl P dolichol metabolic process
GO:0006488 IEA:Ensembl P dolichol-linked oligosaccharide biosynthetic process
GO:0016095 IEA:Ensembl P polyprenol catabolic process

KEGG Pathway Links

KEGG Pathway ID Description
ko00140 Steroid hormone biosynthesis
mcc00140 Steroid hormone biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR001104 3-oxo-5-alpha-steroid 4-dehydrogenase, C-terminal

UniProt Annotations

Entry Information

Gene Name
steroid 5 alpha-reductase 3
Protein Entry
F6R6P8_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014904 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109074803 RefSeq XP_001088853 318 steroid 5 alpha-reductase 3

Identical Sequences to LMP014904 proteins

Reference Database Accession Length Protein Name
GI:383872832 GenBank AFE66544.1 318 putative polyprenol reductase [Macaca mulatta]

Related Sequences to LMP014904 proteins

Reference Database Accession Length Protein Name
GI:383872832 RefSeq XP_003898926.1 318 PREDICTED: polyprenol reductase [Papio anubis]
GI:383872832 RefSeq XP_005555326.1 318 PREDICTED: polyprenol reductase [Macaca fascicularis]
GI:383872832 RefSeq XP_007996877.1 318 PREDICTED: polyprenol reductase [Chlorocebus sabaeus]