Gene/Proteome Database (LMPD)
Proteins
| CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 | |
|---|---|
| Refseq ID | NP_001253604 |
| Protein GI | 388454282 |
| UniProt ID | H9FYK1 |
| mRNA ID | NM_001266675 |
| Length | 333 |
| Protein sequence is identical to GI:297269592 (mRNA isoform) | |
| Refseq ID | XP_002799895 |
| Protein GI | 297269592 |
| UniProt ID | H9FYK1 |
| mRNA ID | XM_002799852 |
| Length | 333 |
| MVSKSRWKLLAMLALVLVVMVLYSISREDRYIELFYFPIPEKKEPCLQGEAERKASKLFGNYSRDQPIFLQLKDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPENIQSLRCRRCVVVGNGHRLRNSSLGDAINKYDVVIRLNNAPVAGYEGDVGSKTTMRLFYPESAHFDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIAADKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMVGSGHNVSQEALAIKRMLEMGAVKNLTSF | |
| Refseq ID | XP_002799898 |
| Protein GI | 297269600 |
| UniProt ID | H9FYK1 |
| mRNA ID | XM_002799852 |
| Length | 333 |
| Protein sequence is identical to GI:297269592 (mRNA isoform) | |
| Refseq ID | XP_002799897 |
| Protein GI | 297269598 |
| UniProt ID | H9FYK1 |
| mRNA ID | XM_002799852 |
| Length | 333 |
| Protein sequence is identical to GI:297269592 (mRNA isoform) | |
| Refseq ID | XP_002799896 |
| Protein GI | 297269596 |
| UniProt ID | H9FYK1 |
| mRNA ID | XM_002799852 |
| Length | 333 |
| Protein sequence is identical to GI:297269592 (mRNA isoform) | |
Gene Information
Entrez Gene ID
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 4
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0030173 | IEA:InterPro | C | integral component of Golgi membrane |
| GO:0008373 | IEA:InterPro | F | sialyltransferase activity |
| GO:0006486 | IEA:InterPro | P | protein glycosylation |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 4
Protein Entry
H9FYK1_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014912 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 297269592 | RefSeq | XP_002799895 | 333 | ST3 beta-galactoside alpha-2,3-sialyltransferase 4 |
Identical Sequences to LMP014912 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:388454282 | RefSeq | XP_009185902.1 | 333 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X1 [Papio anubis] |
| GI:388454282 | RefSeq | XP_009185903.1 | 333 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X1 [Papio anubis] |
| GI:388454282 | RefSeq | XP_009185904.1 | 333 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X1 [Papio anubis] |
| GI:388454282 | RefSeq | XP_009185905.1 | 333 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X1 [Papio anubis] |
Related Sequences to LMP014912 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|