Gene/Proteome Database (LMPD)
Proteins
CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 | |
---|---|
Refseq ID | NP_001253604 |
Protein GI | 388454282 |
UniProt ID | H9FYK1 |
mRNA ID | NM_001266675 |
Length | 333 |
Protein sequence is identical to GI:297269592 (mRNA isoform) |
Refseq ID | XP_002799895 |
Protein GI | 297269592 |
UniProt ID | H9FYK1 |
mRNA ID | XM_002799852 |
Length | 333 |
MVSKSRWKLLAMLALVLVVMVLYSISREDRYIELFYFPIPEKKEPCLQGEAERKASKLFGNYSRDQPIFLQLKDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPENIQSLRCRRCVVVGNGHRLRNSSLGDAINKYDVVIRLNNAPVAGYEGDVGSKTTMRLFYPESAHFDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIAADKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMVGSGHNVSQEALAIKRMLEMGAVKNLTSF |
Refseq ID | XP_002799898 |
Protein GI | 297269600 |
UniProt ID | H9FYK1 |
mRNA ID | XM_002799852 |
Length | 333 |
Protein sequence is identical to GI:297269592 (mRNA isoform) |
Refseq ID | XP_002799897 |
Protein GI | 297269598 |
UniProt ID | H9FYK1 |
mRNA ID | XM_002799852 |
Length | 333 |
Protein sequence is identical to GI:297269592 (mRNA isoform) |
Refseq ID | XP_002799896 |
Protein GI | 297269596 |
UniProt ID | H9FYK1 |
mRNA ID | XM_002799852 |
Length | 333 |
Protein sequence is identical to GI:297269592 (mRNA isoform) |
Gene Information
Entrez Gene ID
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 4
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0030173 | IEA:InterPro | C | integral component of Golgi membrane |
GO:0008373 | IEA:InterPro | F | sialyltransferase activity |
GO:0006486 | IEA:InterPro | P | protein glycosylation |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 4
Protein Entry
H9FYK1_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014912 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
297269592 | RefSeq | XP_002799895 | 333 | ST3 beta-galactoside alpha-2,3-sialyltransferase 4 |
Identical Sequences to LMP014912 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:388454282 | RefSeq | XP_009185902.1 | 333 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X1 [Papio anubis] |
GI:388454282 | RefSeq | XP_009185903.1 | 333 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X1 [Papio anubis] |
GI:388454282 | RefSeq | XP_009185904.1 | 333 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X1 [Papio anubis] |
GI:388454282 | RefSeq | XP_009185905.1 | 333 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X1 [Papio anubis] |
Related Sequences to LMP014912 proteins
Reference | Database | Accession | Length | Protein Name |
---|