Gene/Proteome Database (LMPD)

LMPD ID
LMP014912
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 4
Gene Symbol
Alternate Names
CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4;
Chromosome
14
Map Location
chromosome:14

Proteins

CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4
Refseq ID NP_001253604
Protein GI 388454282
UniProt ID H9FYK1
mRNA ID NM_001266675
Length 333
Protein sequence is identical to GI:297269592 (mRNA isoform)
Refseq ID XP_002799895
Protein GI 297269592
UniProt ID H9FYK1
mRNA ID XM_002799852
Length 333
MVSKSRWKLLAMLALVLVVMVLYSISREDRYIELFYFPIPEKKEPCLQGEAERKASKLFGNYSRDQPIFLQLKDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPENIQSLRCRRCVVVGNGHRLRNSSLGDAINKYDVVIRLNNAPVAGYEGDVGSKTTMRLFYPESAHFDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIAADKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMVGSGHNVSQEALAIKRMLEMGAVKNLTSF
Refseq ID XP_002799898
Protein GI 297269600
UniProt ID H9FYK1
mRNA ID XM_002799852
Length 333
Protein sequence is identical to GI:297269592 (mRNA isoform)
Refseq ID XP_002799897
Protein GI 297269598
UniProt ID H9FYK1
mRNA ID XM_002799852
Length 333
Protein sequence is identical to GI:297269592 (mRNA isoform)
Refseq ID XP_002799896
Protein GI 297269596
UniProt ID H9FYK1
mRNA ID XM_002799852
Length 333
Protein sequence is identical to GI:297269592 (mRNA isoform)

Gene Information

Entrez Gene ID
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 4
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0030173 IEA:InterPro C integral component of Golgi membrane
GO:0008373 IEA:InterPro F sialyltransferase activity
GO:0006486 IEA:InterPro P protein glycosylation

KEGG Pathway Links

KEGG Pathway ID Description
ko00601 Glycosphingolipid biosynthesis - lacto and neolacto series
mcc00601 Glycosphingolipid biosynthesis - lacto and neolacto series
mcc01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR001675 Glycosyl transferase, family 29
IPR012163 Sialyltransferase

UniProt Annotations

Entry Information

Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 4
Protein Entry
H9FYK1_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014912 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
297269592 RefSeq XP_002799895 333 ST3 beta-galactoside alpha-2,3-sialyltransferase 4

Identical Sequences to LMP014912 proteins

Reference Database Accession Length Protein Name
GI:388454282 RefSeq XP_009185902.1 333 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X1 [Papio anubis]
GI:388454282 RefSeq XP_009185903.1 333 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X1 [Papio anubis]
GI:388454282 RefSeq XP_009185904.1 333 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X1 [Papio anubis]
GI:388454282 RefSeq XP_009185905.1 333 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X1 [Papio anubis]

Related Sequences to LMP014912 proteins

Reference Database Accession Length Protein Name