Gene/Proteome Database (LMPD)
Proteins
lactosylceramide alpha-2,3-sialyltransferase | |
---|---|
Refseq ID | NP_001244429 |
Protein GI | 383873109 |
UniProt ID | F7A1D7 |
mRNA ID | NM_001257500 |
Length | 418 |
Protein sequence is identical to GI:297266452 (mRNA isoform) |
Refseq ID | XP_001090769 |
Protein GI | 297266452 |
UniProt ID | F7A1D7 |
mRNA ID | XM_001090769 |
Length | 418 |
MRRKAAGWAERRPLQPRTEAAAAPAGRAMPSEYTYVKLRSDCSRPSLQWYTRAQSKMRRPSLLLKDILKCTLLVFGVWILYILKLNYTTEECDMKKMHYVDPDRVKRAQKYAQQVLQKECRPKFAKTSMAMLFEHRYSVDLLPFVHKAPKDSETESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGSGGILHGLELGHTLNQFDVVIRLNSAPVEGYSEHVGNKTTIRMTYPEGAPLSDLEYYSNDLFVAVLFKSVDFNWLQAMVKNETLPFWVRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWGRDKNVPTIGVIAVVLATHLCDEVSLAGFGYDLNQPRTPLHYFDNQCMAAMNFQTMHNVTTETKFLLKLVKEGVVKDLSGGIHCEF |
Gene Information
Entrez Gene ID
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 5
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0030173 | IEA:InterPro | C | integral component of Golgi membrane |
GO:0047291 | IEA:Ensembl | F | lactosylceramide alpha-2,3-sialyltransferase activity |
GO:0006486 | IEA:InterPro | P | protein glycosylation |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko00604 | Glycosphingolipid biosynthesis - ganglio series |
mcc00604 | Glycosphingolipid biosynthesis - ganglio series |
M00069 | Glycosphingolipid biosynthesis, ganglio series, LacCer => GT3 |
mcc_M00069 | Glycosphingolipid biosynthesis, ganglio series, LacCer => GT3 |
mcc01100 | Metabolic pathways |
Domain Information
UniProt Annotations
Entry Information
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 5
Protein Entry
F7A1D7_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014913 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
297266452 | RefSeq | XP_001090769 | 418 | ST3 beta-galactoside alpha-2,3-sialyltransferase 5 |
Identical Sequences to LMP014913 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:383873109 | GenBank | AFE66481.1 | 418 | lactosylceramide alpha-2,3-sialyltransferase isoform 1 [Macaca mulatta] |
GI:383873109 | RefSeq | XP_003908967.1 | 418 | PREDICTED: lactosylceramide alpha-2,3-sialyltransferase isoform X2 [Papio anubis] |
GI:383873109 | RefSeq | XP_005575450.1 | 418 | PREDICTED: lactosylceramide alpha-2,3-sialyltransferase isoform X3 [Macaca fascicularis] |
Related Sequences to LMP014913 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:383873109 | RefSeq | XP_007968187.1 | 418 | PREDICTED: lactosylceramide alpha-2,3-sialyltransferase isoform X3 [Chlorocebus sabaeus] |