Gene/Proteome Database (LMPD)

LMPD ID
LMP014913
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 5
Gene Symbol
Alternate Names
lactosylceramide alpha-2,3-sialyltransferase;
Chromosome
13
Map Location
chromosome:13

Proteins

lactosylceramide alpha-2,3-sialyltransferase
Refseq ID NP_001244429
Protein GI 383873109
UniProt ID F7A1D7
mRNA ID NM_001257500
Length 418
Protein sequence is identical to GI:297266452 (mRNA isoform)
Refseq ID XP_001090769
Protein GI 297266452
UniProt ID F7A1D7
mRNA ID XM_001090769
Length 418
MRRKAAGWAERRPLQPRTEAAAAPAGRAMPSEYTYVKLRSDCSRPSLQWYTRAQSKMRRPSLLLKDILKCTLLVFGVWILYILKLNYTTEECDMKKMHYVDPDRVKRAQKYAQQVLQKECRPKFAKTSMAMLFEHRYSVDLLPFVHKAPKDSETESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGSGGILHGLELGHTLNQFDVVIRLNSAPVEGYSEHVGNKTTIRMTYPEGAPLSDLEYYSNDLFVAVLFKSVDFNWLQAMVKNETLPFWVRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWGRDKNVPTIGVIAVVLATHLCDEVSLAGFGYDLNQPRTPLHYFDNQCMAAMNFQTMHNVTTETKFLLKLVKEGVVKDLSGGIHCEF

Gene Information

Entrez Gene ID
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 5
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0030173 IEA:InterPro C integral component of Golgi membrane
GO:0047291 IEA:Ensembl F lactosylceramide alpha-2,3-sialyltransferase activity
GO:0006486 IEA:InterPro P protein glycosylation

KEGG Pathway Links

KEGG Pathway ID Description
ko00604 Glycosphingolipid biosynthesis - ganglio series
mcc00604 Glycosphingolipid biosynthesis - ganglio series
M00069 Glycosphingolipid biosynthesis, ganglio series, LacCer => GT3
mcc_M00069 Glycosphingolipid biosynthesis, ganglio series, LacCer => GT3
mcc01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR001675 Glycosyl transferase, family 29
IPR012163 Sialyltransferase

UniProt Annotations

Entry Information

Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 5
Protein Entry
F7A1D7_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014913 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
297266452 RefSeq XP_001090769 418 ST3 beta-galactoside alpha-2,3-sialyltransferase 5

Identical Sequences to LMP014913 proteins

Reference Database Accession Length Protein Name
GI:383873109 GenBank AFE66481.1 418 lactosylceramide alpha-2,3-sialyltransferase isoform 1 [Macaca mulatta]
GI:383873109 RefSeq XP_003908967.1 418 PREDICTED: lactosylceramide alpha-2,3-sialyltransferase isoform X2 [Papio anubis]
GI:383873109 RefSeq XP_005575450.1 418 PREDICTED: lactosylceramide alpha-2,3-sialyltransferase isoform X3 [Macaca fascicularis]

Related Sequences to LMP014913 proteins

Reference Database Accession Length Protein Name
GI:383873109 RefSeq XP_007968187.1 418 PREDICTED: lactosylceramide alpha-2,3-sialyltransferase isoform X3 [Chlorocebus sabaeus]