Gene/Proteome Database (LMPD)

LMPD ID
LMP014930
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
StAR-related lipid transfer (START) domain containing 4
Gene Symbol
Alternate Names
stAR-related lipid transfer protein 4; START domain-containing protein 4;
Chromosome
6
Map Location
chromosome:6

Proteins

stAR-related lipid transfer protein 4
Refseq ID NP_001247863
Protein GI 386781320
UniProt ID F6UQ11
mRNA ID NM_001260934
Length 205
Protein sequence is identical to GI:109078164 (mRNA isoform)
Refseq ID XP_001101152
Protein GI 109078164
UniProt ID F6UQ11
mRNA ID XM_001101152
Length 205
MEGLSDVASFATKLKNTLIQYHSIEEDKWRVAKKTKDVTVWRKPSEEFNGYLYKAQGVIDDLVNSIIDHIRPGPCRLDWDSLMTSLDILENFEENCCVMRYTTAGQLWNIISPREFVDFSYTVGYKEGLLSCGISLDWDEKRPEFVRGYNHPCGWFCVPLKDNPNQSLLTGYIQTDLRGMIPQSAVDTAMASTLTNFYGDLRKAL

Gene Information

Entrez Gene ID
Gene Name
StAR-related lipid transfer (START) domain containing 4
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0008289 IEA:InterPro F lipid binding

Domain Information

InterPro Annotations

Accession Description
IPR023393 START-like domain
IPR002913 START_lipid-bd_dom

UniProt Annotations

Entry Information

Gene Name
StAR-related lipid transfer (START) domain containing 4
Protein Entry
F6UQ11_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014930 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109078164 RefSeq XP_001101152 205 StAR-related lipid transfer (START) domain containing 4

Identical Sequences to LMP014930 proteins

Reference Database Accession Length Protein Name
GI:386781320 RefSeq XP_005557558.1 205 PREDICTED: stAR-related lipid transfer protein 4 [Macaca fascicularis]
GI:386781320 RefSeq XP_008012312.1 205 PREDICTED: stAR-related lipid transfer protein 4 [Chlorocebus sabaeus]
GI:386781320 RefSeq XP_008950348.1 205 PREDICTED: stAR-related lipid transfer protein 4 [Pan paniscus]
GI:386781320 RefSeq XP_009447726.1 205 PREDICTED: stAR-related lipid transfer protein 4 isoform X1 [Pan troglodytes]

Related Sequences to LMP014930 proteins

Reference Database Accession Length Protein Name
GI:386781320 GenBank EHH26701.1 205 START domain-containing protein 4 [Macaca mulatta]
GI:386781320 GenBank EHH54441.1 205 START domain-containing protein 4 [Macaca fascicularis]
GI:386781320 RefSeq XP_517874.2 205 PREDICTED: stAR-related lipid transfer protein 4 isoform X1 [Pan troglodytes]