Gene/Proteome Database (LMPD)
Proteins
stAR-related lipid transfer protein 4 | |
---|---|
Refseq ID | NP_001247863 |
Protein GI | 386781320 |
UniProt ID | F6UQ11 |
mRNA ID | NM_001260934 |
Length | 205 |
Protein sequence is identical to GI:109078164 (mRNA isoform) |
Refseq ID | XP_001101152 |
Protein GI | 109078164 |
UniProt ID | F6UQ11 |
mRNA ID | XM_001101152 |
Length | 205 |
MEGLSDVASFATKLKNTLIQYHSIEEDKWRVAKKTKDVTVWRKPSEEFNGYLYKAQGVIDDLVNSIIDHIRPGPCRLDWDSLMTSLDILENFEENCCVMRYTTAGQLWNIISPREFVDFSYTVGYKEGLLSCGISLDWDEKRPEFVRGYNHPCGWFCVPLKDNPNQSLLTGYIQTDLRGMIPQSAVDTAMASTLTNFYGDLRKAL |
Gene Information
Entrez Gene ID
Gene Name
StAR-related lipid transfer (START) domain containing 4
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0008289 | IEA:InterPro | F | lipid binding |
Domain Information
UniProt Annotations
Entry Information
Gene Name
StAR-related lipid transfer (START) domain containing 4
Protein Entry
F6UQ11_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014930 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109078164 | RefSeq | XP_001101152 | 205 | StAR-related lipid transfer (START) domain containing 4 |
Identical Sequences to LMP014930 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:386781320 | RefSeq | XP_005557558.1 | 205 | PREDICTED: stAR-related lipid transfer protein 4 [Macaca fascicularis] |
GI:386781320 | RefSeq | XP_008012312.1 | 205 | PREDICTED: stAR-related lipid transfer protein 4 [Chlorocebus sabaeus] |
GI:386781320 | RefSeq | XP_008950348.1 | 205 | PREDICTED: stAR-related lipid transfer protein 4 [Pan paniscus] |
GI:386781320 | RefSeq | XP_009447726.1 | 205 | PREDICTED: stAR-related lipid transfer protein 4 isoform X1 [Pan troglodytes] |
Related Sequences to LMP014930 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:386781320 | GenBank | EHH26701.1 | 205 | START domain-containing protein 4 [Macaca mulatta] |
GI:386781320 | GenBank | EHH54441.1 | 205 | START domain-containing protein 4 [Macaca fascicularis] |
GI:386781320 | RefSeq | XP_517874.2 | 205 | PREDICTED: stAR-related lipid transfer protein 4 isoform X1 [Pan troglodytes] |