Gene/Proteome Database (LMPD)
Proteins
| stAR-related lipid transfer protein 5 | |
|---|---|
| Refseq ID | NP_001247845 |
| Protein GI | 386781203 |
| UniProt ID | F7BSW5 |
| mRNA ID | NM_001260916 |
| Length | 213 |
| Protein sequence is identical to GI:109082139 (mRNA isoform) | |
| Refseq ID | XP_001110144 |
| Protein GI | 109082139 |
| UniProt ID | F7BSW5 |
| mRNA ID | XM_001110144 |
| Length | 213 |
| MDPTLAAQTSEAVAEKVLRYRRDTAGWKICREGNGVSVSWRPSVEFPGNLYRGEGIVYGTPEEVWDCVKPAVGGLRVKWDENVTGFEIIQSITDTLCVSRTSTPSAAMKLISPRDFVDLVLVKRYEDGTISSNATHVEHPLCPPKPGFVRGFNHPCGCFCEPLPGEPTKTNLVTFFHTDLSGYLPQNVVDSFFPRSMTRFYANLQKAVKQFHE | |
Gene Information
Entrez Gene ID
Gene Name
StAR-related lipid transfer (START) domain containing 5
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0008289 | IEA:InterPro | F | lipid binding |
Domain Information
UniProt Annotations
Entry Information
Gene Name
StAR-related lipid transfer (START) domain containing 5
Protein Entry
F7BSW5_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014931 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109082139 | RefSeq | XP_001110144 | 213 | StAR-related lipid transfer (START) domain containing 5 |
Identical Sequences to LMP014931 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:386781203 | GenBank | EHH27540.1 | 213 | START domain-containing protein 5 [Macaca mulatta] |
| GI:386781203 | GenBank | EHH63283.1 | 213 | START domain-containing protein 5 [Macaca fascicularis] |
| GI:386781203 | GenBank | AFE66459.1 | 213 | stAR-related lipid transfer protein 5 [Macaca mulatta] |
| GI:386781203 | GenBank | AFI34150.1 | 213 | stAR-related lipid transfer protein 5 [Macaca mulatta] |
Related Sequences to LMP014931 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|