Gene/Proteome Database (LMPD)
Proteins
stAR-related lipid transfer protein 7, mitochondrial | |
---|---|
Refseq ID | NP_001247841 |
Protein GI | 386781179 |
UniProt ID | H9EQZ0 |
mRNA ID | NM_001260912 |
Length | 370 |
Protein sequence is identical to GI:297266527 (mRNA isoform) |
Refseq ID | XP_001097200 |
Protein GI | 297266527 |
UniProt ID | H9EQZ0 |
mRNA ID | XM_001097200 |
Length | 370 |
MFPRRLLAAWLAGARGGGLLALLANQCRFVTGLRVRRAQQIAQLYGRLYSERSRRVLLGRLWRRLHGRPGHASALMAAFAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQPWEMVMDKKHFKLWRRPITGTHLYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDVVSGSEVLHWVTHFPYPMYSRDYVYVRRYSVDQENNMMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHMATLKAKNMEIKVKDYISAKPLEMSSEAKATSQSSERKNEGSCGPAQIEYA |
Gene Information
Entrez Gene ID
Gene Name
StAR-related lipid transfer (START) domain containing 7
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0008289 | IEA:InterPro | F | lipid binding |
Domain Information
UniProt Annotations
Entry Information
Gene Name
StAR-related lipid transfer (START) domain containing 7
Protein Entry
H9EQZ0_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014933 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
297266527 | RefSeq | XP_001097200 | 370 | StAR-related lipid transfer (START) domain containing 7 |
Identical Sequences to LMP014933 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:386781179 | GenBank | AFH33264.1 | 370 | stAR-related lipid transfer protein 7, mitochondrial precursor [Macaca mulatta] |
GI:386781179 | GenBank | AFI33919.1 | 370 | stAR-related lipid transfer protein 7, mitochondrial precursor [Macaca mulatta] |
GI:386781179 | RefSeq | XP_003909022.1 | 370 | PREDICTED: stAR-related lipid transfer protein 7, mitochondrial [Papio anubis] |
GI:386781179 | RefSeq | XP_005575037.1 | 370 | PREDICTED: stAR-related lipid transfer protein 7, mitochondrial [Macaca fascicularis] |
Related Sequences to LMP014933 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:386781179 | GenBank | AFE64799.1 | 370 | stAR-related lipid transfer protein 7, mitochondrial precursor [Macaca mulatta] |