Gene/Proteome Database (LMPD)
Proteins
| succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial | |
|---|---|
| Refseq ID | NP_001248050 |
| Protein GI | 386780892 |
| UniProt ID | F6Y3Q6 |
| mRNA ID | NM_001261121 |
| Length | 432 |
| Protein sequence is identical to GI:109036827 (mRNA isoform) | |
| Refseq ID | XP_001089976 |
| Protein GI | 109036827 |
| UniProt ID | F6Y3Q6 |
| mRNA ID | XM_001089976 |
| Length | 432 |
| MASPVATQAGKLLRALALRPRFLAVGSQAAQLTSRRWLNLQEYQSKKLMSDNGVRVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFNSGLKGGVHLTKDPNVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIFEGIKDSQAQRMAENLGFVGPLKSQAADQITKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKEAQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVQEAQKILSNSGLPITSAVDLEDAAKKAVASVAKK | |
Gene Information
Entrez Gene ID
Gene Name
succinate-CoA ligase, GDP-forming, beta subunit
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005524 | IEA:InterPro | F | ATP binding |
| GO:0016874 | IEA:UniProtKB-KW | F | ligase activity |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko01200 | Carbon metabolism |
| mcc01200 | Carbon metabolism |
| ko00020 | Citrate cycle (TCA cycle) |
| mcc00020 | Citrate cycle (TCA cycle) |
| M00009 | Citrate cycle (TCA cycle, Krebs cycle) |
| mcc_M00009 | Citrate cycle (TCA cycle, Krebs cycle) |
| M00011 | Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate |
| mcc_M00011 | Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate |
| mcc01100 | Metabolic pathways |
| ko00640 | Propanoate metabolism |
| mcc00640 | Propanoate metabolism |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR005811 | ATP-citrate lyase/succinyl-CoA ligase |
| IPR013815 | ATP-grasp fold, subdomain 1 |
| IPR013816 | ATP-grasp fold, subdomain 2 |
| IPR013650 | ATP-grasp fold, succinyl-CoA synthetase-type |
| IPR005809 | Succinyl-CoA synthetase, beta subunit |
| IPR017866 | Succinyl-CoA synthetase, beta subunit, conserved site |
| IPR016102 | Succinyl-CoA synthetase-like |
UniProt Annotations
Entry Information
Gene Name
succinate-CoA ligase, GDP-forming, beta subunit
Protein Entry
F6Y3Q6_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014947 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109036827 | RefSeq | XP_001089976 | 432 | succinate-CoA ligase, GDP-forming, beta subunit |
Identical Sequences to LMP014947 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:386780892 | GenBank | AFE80678.1 | 432 | succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial isoform 2 precursor [Macaca mulatta] |
| GI:386780892 | GenBank | AFH34460.1 | 432 | succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial isoform 2 precursor [Macaca mulatta] |
| GI:386780892 | RefSeq | XP_005547621.1 | 432 | PREDICTED: succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial-like isoform X2 [Macaca fascicularis] |
Related Sequences to LMP014947 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:386780892 | RefSeq | XP_010360507.1 | 432 | PREDICTED: succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial isoform X1 [Rhinopithecus roxellana] |