Gene/Proteome Database (LMPD)

LMPD ID
LMP014988
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
UbiA prenyltransferase domain containing 1
Gene Symbol
Alternate Names
ubiA prenyltransferase domain-containing protein 1;
Chromosome
1
Map Location
chromosome:1

Proteins

ubiA prenyltransferase domain-containing protein 1
Refseq ID NP_001247708
Protein GI 386782035
UniProt ID F7GJ37
mRNA ID NM_001260779
Length 338
Protein sequence is identical to GI:108997038 (mRNA isoform)
Refseq ID XP_001103913
Protein GI 108997038
UniProt ID F7GJ37
mRNA ID XM_001103913
Length 338
MAASQVLGEKINILSGETVKAGDREPLGNDCPEQDRLPQRSWRQKCASYVLALRPWSFSASLTPVALGSALAYRSHGVLDPRLLVGCAVAVLAVHGAGNLVNTYYDFSKGIDHKKSDDRTLVDRILEPQDVVRFGVFLYTLGCVCAACLYCLSPLKLEHLALIYFGGLSGSFLYTGGIGFKYVALGDLIILITFGPLAVMFAYAIQVGSLAIFPLVYAIPLALSTEAILHSNNTRDMESDREAGIVTLAILIGPTFSYILYNTLLFLPYLVFSILATHCTISLALPLLTIPMAFSLERQFRSQAFNKLPQRTAKLNLLLGLFYVFGIILAPAGSLPKL

Gene Information

Entrez Gene ID
Gene Name
UbiA prenyltransferase domain containing 1
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:Ensembl C endoplasmic reticulum
GO:0030173 IEA:Ensembl C integral component of Golgi membrane
GO:0005634 IEA:Ensembl C nucleus
GO:0016209 IEA:Ensembl F antioxidant activity
GO:0004659 IEA:InterPro F prenyltransferase activity
GO:0042371 IEA:Ensembl P vitamin K biosynthetic process

Domain Information

InterPro Annotations

Accession Description
IPR026046 UbiA prenyltransferase domain containing protein 1
IPR000537 UbiA prenyltransferase family

UniProt Annotations

Entry Information

Gene Name
UbiA prenyltransferase domain containing 1
Protein Entry
F7GJ37_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014988 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
108997038 RefSeq XP_001103913 338 UbiA prenyltransferase domain containing 1

Identical Sequences to LMP014988 proteins

Reference Database Accession Length Protein Name
GI:386782035 GenBank AFE65503.1 338 ubiA prenyltransferase domain-containing protein 1 [Macaca mulatta]
GI:386782035 GenBank AFI36951.1 338 ubiA prenyltransferase domain-containing protein 1 [Macaca mulatta]
GI:386782035 GenBank AGC99286.1 338 Sequence 25 from patent US 8334369
GI:386782035 RefSeq XP_003891157.1 338 PREDICTED: ubiA prenyltransferase domain-containing protein 1 [Papio anubis]

Related Sequences to LMP014988 proteins

Reference Database Accession Length Protein Name
GI:386782035 GenBank EHH14321.1 338 hypothetical protein EGK_00226 [Macaca mulatta]
GI:386782035 GenBank EHH49536.1 338 hypothetical protein EGM_00212 [Macaca fascicularis]