Gene/Proteome Database (LMPD)
Proteins
ubiA prenyltransferase domain-containing protein 1 | |
---|---|
Refseq ID | NP_001247708 |
Protein GI | 386782035 |
UniProt ID | F7GJ37 |
mRNA ID | NM_001260779 |
Length | 338 |
Protein sequence is identical to GI:108997038 (mRNA isoform) |
Refseq ID | XP_001103913 |
Protein GI | 108997038 |
UniProt ID | F7GJ37 |
mRNA ID | XM_001103913 |
Length | 338 |
MAASQVLGEKINILSGETVKAGDREPLGNDCPEQDRLPQRSWRQKCASYVLALRPWSFSASLTPVALGSALAYRSHGVLDPRLLVGCAVAVLAVHGAGNLVNTYYDFSKGIDHKKSDDRTLVDRILEPQDVVRFGVFLYTLGCVCAACLYCLSPLKLEHLALIYFGGLSGSFLYTGGIGFKYVALGDLIILITFGPLAVMFAYAIQVGSLAIFPLVYAIPLALSTEAILHSNNTRDMESDREAGIVTLAILIGPTFSYILYNTLLFLPYLVFSILATHCTISLALPLLTIPMAFSLERQFRSQAFNKLPQRTAKLNLLLGLFYVFGIILAPAGSLPKL |
Gene Information
Entrez Gene ID
Gene Name
UbiA prenyltransferase domain containing 1
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:Ensembl | C | endoplasmic reticulum |
GO:0030173 | IEA:Ensembl | C | integral component of Golgi membrane |
GO:0005634 | IEA:Ensembl | C | nucleus |
GO:0016209 | IEA:Ensembl | F | antioxidant activity |
GO:0004659 | IEA:InterPro | F | prenyltransferase activity |
GO:0042371 | IEA:Ensembl | P | vitamin K biosynthetic process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
UbiA prenyltransferase domain containing 1
Protein Entry
F7GJ37_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014988 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
108997038 | RefSeq | XP_001103913 | 338 | UbiA prenyltransferase domain containing 1 |
Identical Sequences to LMP014988 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:386782035 | GenBank | AFE65503.1 | 338 | ubiA prenyltransferase domain-containing protein 1 [Macaca mulatta] |
GI:386782035 | GenBank | AFI36951.1 | 338 | ubiA prenyltransferase domain-containing protein 1 [Macaca mulatta] |
GI:386782035 | GenBank | AGC99286.1 | 338 | Sequence 25 from patent US 8334369 |
GI:386782035 | RefSeq | XP_003891157.1 | 338 | PREDICTED: ubiA prenyltransferase domain-containing protein 1 [Papio anubis] |
Related Sequences to LMP014988 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:386782035 | GenBank | EHH14321.1 | 338 | hypothetical protein EGK_00226 [Macaca mulatta] |
GI:386782035 | GenBank | EHH49536.1 | 338 | hypothetical protein EGM_00212 [Macaca fascicularis] |