Gene/Proteome Database (LMPD)

LMPD ID
LMP014998
Gene ID
574134
Species
Macaca mulatta (Rhesus monkey)
Gene Name
vesicle-associated membrane protein 2 (synaptobrevin 2)
Gene Symbol
VAMP2
Synonyms
SYB2; VAMP-2;
Alternate Names
vesicle-associated membrane protein 2; synaptobrevin-2;
Chromosome
16
Map Location
chromosome:16

Proteins

vesicle-associated membrane protein 2
Refseq ID NP_001027992
Protein GI 74136201
UniProt ID Q9N0Y0
mRNA ID NM_001032820
Length 116
MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST

Gene Information

Entrez Gene ID
574134
Gene Name
vesicle-associated membrane protein 2 (synaptobrevin 2)
Gene Symbol
VAMP2
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0031201 ISS:UniProtKB C SNARE complex
GO:0030054 IEA:UniProtKB-KW C cell junction
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0043005 IEA:UniProtKB-KW C neuron projection
GO:0048471 IEA:Ensembl C perinuclear region of cytoplasm
GO:0005886 IEA:Ensembl C plasma membrane
GO:0030672 IEA:Ensembl C synaptic vesicle membrane
GO:0070044 IEA:Ensembl C synaptobrevin 2-SNAP-25-syntaxin-1a complex
GO:0005802 IEA:Ensembl C trans-Golgi network
GO:0042589 IEA:Ensembl C zymogen granule membrane
GO:0005543 IEA:Ensembl F phospholipid binding
GO:0043001 IEA:Ensembl P Golgi to plasma membrane protein transport
GO:0017156 IEA:Ensembl P calcium ion-dependent exocytosis
GO:0032869 IEA:Ensembl P cellular response to insulin stimulus
GO:0060291 IEA:Ensembl P long-term synaptic potentiation
GO:0061025 IEA:Ensembl P membrane fusion
GO:0090316 IEA:Ensembl P positive regulation of intracellular protein transport
GO:0017157 IEA:Ensembl P regulation of exocytosis
GO:0016079 IEA:Ensembl P synaptic vesicle exocytosis

KEGG Pathway Links

KEGG Pathway ID Description
mcc04911 Insulin secretion
ko04130 SNARE interactions in vesicular transport
mcc04130 SNARE interactions in vesicular transport
ko04970 Salivary secretion
mcc04970 Salivary secretion
ko04721 Synaptic vesicle cycle
mcc04721 Synaptic vesicle cycle
ko04962 Vasopressin-regulated water reabsorption
mcc04962 Vasopressin-regulated water reabsorption

Domain Information

InterPro Annotations

Accession Description
IPR001388 Synaptobrevin
IPR016444 Synaptobrevin/Vesicle-associated membrane protein

UniProt Annotations

Entry Information

Gene Name
vesicle-associated membrane protein 2 (synaptobrevin 2)
Protein Entry
VAMP2_MACMU
UniProt ID
Q9N0Y0
Species
Rhesus monkey

Comments

Comment Type Description
Function Involved in the targeting and/or fusion of transport vesicles to their target membrane.
Similarity Belongs to the synaptobrevin family.
Similarity Contains 1 v-SNARE coiled-coil homology domain.
Subcellular Location Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane ; Single-pass type IV membrane protein Cell junction, synapse, synaptosome Note=Neuronal synaptic vesicles.
Subunit Part of the SNARE core complex containing SNAP25, VAMP2 and STX1A. This complex binds to CPLX1. Interacts with STX4 and BVES. Interacts with VAPA and VAPB (By similarity).

Identical and Related Proteins

Unique RefSeq proteins for LMP014998 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
74136201 RefSeq NP_001027992 116 vesicle-associated membrane protein 2

Identical Sequences to LMP014998 proteins

Reference Database Accession Length Protein Name
GI:74136201 GenBank AIC49821.1 116 VAMP2, partial [synthetic construct]
GI:74136201 RefSeq XP_008268978.1 116 PREDICTED: vesicle-associated membrane protein 2 [Oryctolagus cuniculus]
GI:74136201 RefSeq XP_002827046.3 116 PREDICTED: vesicle-associated membrane protein 2 [Pongo abelii]
GI:74136201 RefSeq XP_010360722.1 116 PREDICTED: vesicle-associated membrane protein 2 [Rhinopithecus roxellana]

Related Sequences to LMP014998 proteins

Reference Database Accession Length Protein Name
GI:74136201 EMBL CAD61610.1 116 unnamed protein product [Homo sapiens]
GI:74136201 GenBank AEP57091.1 116 Sequence 31 from patent US 8022172
GI:74136201 GenBank AEP57092.1 116 Sequence 32 from patent US 8022172
GI:74136201 RefSeq XP_004857539.1 116 PREDICTED: vesicle-associated membrane protein 2 isoform X2 [Heterocephalus glaber]