Gene/Proteome Database (LMPD)

LMPD ID
LMP015021
Gene ID
717016
Species
Macaca mulatta (Rhesus monkey)
Gene Name
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide
Gene Symbol
YWHAH
Alternate Names
14-3-3 protein eta;
Chromosome
10
Map Location
chromosome:10

Proteins

14-3-3 protein eta
Refseq ID NP_001253520
Protein GI 388453445
UniProt ID F6RIX6
mRNA ID NM_001266591
Length 246
Protein sequence is identical to GI:109093926 (mRNA isoform)
Refseq ID XP_001111998
Protein GI 109093926
UniProt ID F6RIX6
mRNA ID XM_001111998
Length 246
MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN

Gene Information

Entrez Gene ID
717016
Gene Name
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide
Gene Symbol
YWHAH
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:Ensembl C cytoplasm
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0005886 IEA:Ensembl C plasma membrane
GO:0017080 IEA:Ensembl F sodium channel regulator activity
GO:0006713 IEA:Ensembl P glucocorticoid catabolic process
GO:0042921 IEA:Ensembl P glucocorticoid receptor signaling pathway
GO:0006886 IEA:Ensembl P intracellular protein transport
GO:0086010 IEA:Ensembl P membrane depolarization during action potential
GO:0050774 IEA:Ensembl P negative regulation of dendrite morphogenesis
GO:0045893 IEA:Ensembl P positive regulation of transcription, DNA-templated
GO:2000649 IEA:Ensembl P regulation of sodium ion transmembrane transporter activity
GO:0021762 IEA:Ensembl P substantia nigra development

KEGG Pathway Links

KEGG Pathway ID Description
ko04110 Cell cycle
mcc04110 Cell cycle
ko05169 Epstein-Barr virus infection
mcc05169 Epstein-Barr virus infection
ko04390 Hippo signaling pathway
mcc04390 Hippo signaling pathway
ko04114 Oocyte meiosis
mcc04114 Oocyte meiosis
ko04151 PI3K-Akt signaling pathway
mcc04151 PI3K-Akt signaling pathway
ko05203 Viral carcinogenesis
mcc05203 Viral carcinogenesis

Domain Information

InterPro Annotations

Accession Description
IPR000308 14-3-3 protein
IPR023409 14-3-3 protein, conserved site
IPR023410 14-3-3_domain

UniProt Annotations

Entry Information

Gene Name
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide
Protein Entry
F6RIX6_MACMU
UniProt ID
F6RIX6
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP015021 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109093926 RefSeq XP_001111998 246 tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide

Identical Sequences to LMP015021 proteins

Reference Database Accession Length Protein Name
GI:388453445 GenBank JAB39292.1 246 14-3-3 protein eta [Callithrix jacchus]
GI:388453445 GenBank AGU04164.1 246 Sequence 55 from patent US 8476008
GI:388453445 GenBank AHD77460.1 246 Sequence 22593 from patent US 8586006
GI:388453445 RefSeq XP_007973739.1 246 PREDICTED: 14-3-3 protein eta isoform X2 [Chlorocebus sabaeus]

Related Sequences to LMP015021 proteins

Reference Database Accession Length Protein Name
GI:388453445 GenBank AGF19182.1 246 Sequence 5 from patent US 8367349
GI:388453445 RefSeq XP_002831082.1 246 PREDICTED: 14-3-3 protein eta [Pongo abelii]
GI:388453445 RefSeq XP_004088556.1 246 PREDICTED: 14-3-3 protein eta isoform 2 [Nomascus leucogenys]