Gene/Proteome Database (LMPD)
Proteins
CAAX prenyl protease 1 homolog | |
---|---|
Refseq ID | NP_001244375 |
Protein GI | 383872882 |
UniProt ID | F6UEH3 |
mRNA ID | NM_001257446 |
Length | 475 |
Protein sequence is identical to GI:109002616 (mRNA isoform) |
Refseq ID | XP_001082852 |
Protein GI | 109002616 |
UniProt ID | F6UEH3 |
mRNA ID | XM_001082852 |
Length | 475 |
MGMWASLDALWEIPAEKRIFGAVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWSGLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPWSLYNTFVIEEKHGFNQQTLGFFMKDAIKKFVVTQCILLPVSSLLLYIIKIGGDYFFIYAWLFTLVVSLVLVTIYADYIAPLFDKFTPLPEGKLKEEIEVMAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEEYSVLNKDIQEDSGMEPRNEEERNSEEIKAKVKNKKQGCKNEEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDSQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMWHYSHPPLLERLQALKSMKQH |
Gene Information
Entrez Gene ID
Gene Name
zinc metallopeptidase STE24 homolog (S. cerevisiae)
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
GO:0016020 | IEA:Ensembl | C | membrane |
GO:0004222 | IEA:Ensembl | F | metalloendopeptidase activity |
GO:0071586 | IEA:InterPro | P | CAAX-box protein processing |
GO:0006998 | IEA:Ensembl | P | nuclear envelope organization |
GO:0030327 | IEA:Ensembl | P | prenylated protein catabolic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
zinc metallopeptidase STE24 homolog (S. cerevisiae)
Protein Entry
F6UEH3_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP015037 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109002616 | RefSeq | XP_001082852 | 475 | zinc metallopeptidase STE24 homolog (S. cerevisiae) |
Identical Sequences to LMP015037 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:383872882 | GenBank | AFE65556.1 | 475 | CAAX prenyl protease 1 homolog [Macaca mulatta] |
GI:383872882 | GenBank | AFH30737.1 | 475 | CAAX prenyl protease 1 homolog [Macaca mulatta] |
GI:383872882 | GenBank | AFI33539.1 | 475 | CAAX prenyl protease 1 homolog [Macaca mulatta] |
GI:383872882 | RefSeq | XP_005543896.1 | 475 | PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Macaca fascicularis] |
Related Sequences to LMP015037 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:383872882 | GenBank | EHH14652.1 | 475 | hypothetical protein EGK_00615 [Macaca mulatta] |