Gene/Proteome Database (LMPD)

LMPD ID
LMP000026
Gene ID
26458
Species
Mus musculus (Mouse)
Gene Name
solute carrier family 27 (fatty acid transporter), member 2
Gene Symbol
Slc27a2
Synonyms
ACSVL1; FATP2; VLCS; Vlac; Vlacs
Alternate Names
very long-chain acyl-CoA synthetase; FATP-2; THCA-CoA ligase; fatty acid transport protein 2; long-chain-fatty-acid--CoA ligase; solute carrier family 27 member 2; very long-chain-fatty-acid-CoA ligase; fatty-acid-coenzyme A ligase, very long-chain 1; very long-chain acyl-Coenzyme A dehydrogenase synthase
Chromosome
2
Map Location
2 F1|2
EC Number
6.2.1.-

Proteins

very long-chain acyl-CoA synthetase
Refseq ID NP_036108
Protein GI 113374154
UniProt ID O35488
mRNA ID NM_011978
Length 620
RefSeq Status VALIDATED
MLPVLYTGLAGLLLLPLLLTCCCPYLLQDVRYFLRLANMARRVRSYRQRRPVRTILRAFLEQARKTPHKPFLLFRDETLTYAQVDRRSNQVARALHDQLGLRQGDCVALFMGNEPAYVWIWLGLLKLGCPMACLNYNIRAKSLLHCFQCCGAKVLLASPDLQEAVEEVLPTLKKDAVSVFYVSRTSNTNGVDTILDKVDGVSAEPTPESWRSEVTFTTPAVYIYTSGTTGLPKAATINHHRLWYGTGLAMSSGITAQDVIYTTMPLYHSAALMIGLHGCIVVGATLALRSKFSASQFWDDCRKYNVTVIQYIGELLRYLCNTPQKPNDRDHKVKKALGNGLRGDVWREFIKRFGDIHVYEFYASTEGNIGFVNYPRKIGAVGRANYLQRKVARYELIKYDVEKDEPVRDANGYCIKVPKGEVGLLVCKITQLTPFIGYAGGKTQTEKKKLRDVFKKGDIYFNSGDLLMIDRENFVYFHDRVGDTFRWKGENVATTEVADIVGLVDFVEEVNVYGVPVPGHEGRIGMASLKIKENYEFNGKKLFQHIAEYLPSYARPRFLRIQDTIEITGTFKHRKVTLMEEGFNPTVIKDTLYFMDDAEKTFVPMTENIYNAIIDKTLKL

Gene Information

Entrez Gene ID
26458
Gene Name
solute carrier family 27 (fatty acid transporter), member 2
Gene Symbol
Slc27a2
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IDA:MGI C endoplasmic reticulum
GO:0005788 ISS:UniProtKB C endoplasmic reticulum lumen
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0030176 IEA:Ensembl C integral component of endoplasmic reticulum membrane
GO:0005779 ISS:UniProtKB C integral component of peroxisomal membrane
GO:0005739 IDA:MGI C mitochondrion
GO:0005777 IDA:MGI C peroxisome
GO:0005524 IEA:UniProtKB-KW F ATP binding
GO:0015245 IDA:MGI F fatty acid transporter activity
GO:0004467 IDA:MGI F long-chain fatty acid-CoA ligase activity
GO:0050197 IEA:Ensembl F phytanate-CoA ligase activity
GO:0070251 IEA:Ensembl F pristanate-CoA ligase activity
GO:0031957 IDA:MGI F very long-chain fatty acid-CoA ligase activity
GO:0006699 IEA:Ensembl P bile acid biosynthetic process
GO:0001561 IEA:Ensembl P fatty acid alpha-oxidation
GO:0006635 IEA:Ensembl P fatty acid beta-oxidation
GO:0015908 IDA:MGI P fatty acid transport
GO:0044539 IEA:Ensembl P long-chain fatty acid import
GO:0001676 IDA:MGI P long-chain fatty acid metabolic process
GO:0097089 IEA:Ensembl P methyl-branched fatty acid metabolic process
GO:0042760 IMP:MGI P very long-chain fatty acid catabolic process
GO:0000038 IDA:MGI P very long-chain fatty acid metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
mmu03320 PPAR signaling pathway
mmu04146 Peroxisome

REACTOME Pathway Links

REACTOME Pathway ID Description
5893443 Synthesis of bile acids and bile salts via 24-hydroxycholesterol

Domain Information

InterPro Annotations

Accession Description
IPR025110 AMP-binding enzyme C-terminal domain
IPR020845 AMP-binding, conserved site
IPR000873 AMP-dependent synthetase/ligase

UniProt Annotations

Entry Information

Gene Name
solute carrier family 27 (fatty acid transporter), member 2
Protein Entry
S27A2_MOUSE
UniProt ID
O35488
Species
Mouse

Comments

Comment Type Description
Catalytic Activity ATP + a long-chain fatty acid + CoA = AMP + diphosphate + an acyl-CoA.
Catalytic Activity ATP + a very-long-chain carboxylic acid + CoA = AMP + diphosphate + an acyl-CoA.
Function Acyl-CoA synthetase probably involved in bile acid metabolism. Proposed to activate C27 precurors of bile acids to their CoA thioesters derivatives before side chain cleavage via peroxisomal beta-oxidation occurs. In vitro, activates 3-alpha,7- alpha,12-alpha-trihydroxy-5-beta-cholestanate (THCA), the C27 precursor of cholic acid deriving from the de novo synthesis from cholesterol. Does not utilize C24 bile acids as substrates. In vitro, also activates long- and branched-chain fatty acids and may have additional roles in fatty acid metabolism (By similarity). May be involved in translocation of long-chain fatty acids (LFCA) across membranes. {ECO:0000250, ECO:0000269|PubMed:15699031}.
Sequence Caution Sequence=AAC40186.1; Type=Frameshift; Positions=253, 263, 267, 281, 289, 293, 299, 301, 307; Evidence={ECO:0000305};
Similarity Belongs to the ATP-dependent AMP-binding enzyme family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Peroxisome membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Note=Peripheral membrane associated with the lumenal side of peroxisomes. {ECO:0000250}.
Tissue Specificity Strong expression in liver and kidney, low expression in brain and testis, no expression in skeletal muscle and spleen. Shows uniform distribution in liver acinus. {ECO:0000269|PubMed:11980911}.

Identical and Related Proteins

Unique RefSeq proteins for LMP000026 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
113374154 RefSeq NP_036108 620 very long-chain acyl-CoA synthetase

Identical Sequences to LMP000026 proteins

Reference Database Accession Length Protein Name
GI:113374154 GenBank AAH13442.1 620 Solute carrier family 27 (fatty acid transporter), member 2 [Mus musculus]
GI:113374154 GenBank AAH22170.1 620 Solute carrier family 27 (fatty acid transporter), member 2 [Mus musculus]
GI:113374154 GenBank AAH24735.1 620 Solute carrier family 27 (fatty acid transporter), member 2 [Mus musculus]
GI:113374154 SwissProt O35488.2 620 RecName: Full=Very long-chain acyl-CoA synthetase; Short=VLACS; Short=VLCS; AltName: Full=Fatty acid transport protein 2; Short=FATP-2; AltName: Full=Fatty-acid-coenzyme A ligase, very long-chain 1; AltName: Full=Long-chain-fatty-acid--CoA ligase; AltName: Full=Solute carrier family 27 member 2; AltName: Full=THCA-CoA ligase; AltName: Full=Very long-chain-fatty-acid-CoA ligase [Mus musculus]

Related Sequences to LMP000026 proteins

Reference Database Accession Length Protein Name
GI:113374154 DBBJ BAE25684.1 614 unnamed protein product, partial [Mus musculus]
GI:113374154 EMBL CAA11687.1 620 very-long-chain acyl-CoA synthetase [Mus musculus]
GI:113374154 GenBank AAB87982.1 620 very-long-chain acyl-CoA synthetase [Mus musculus]
GI:113374154 GenBank AAE81570.1 620 Sequence 93 from patent US 6288213
GI:113374154 GenBank AAE92245.1 620 Sequence 93 from patent US 6348321
GI:113374154 GenBank ABH70765.1 620 Sequence 93 from patent US 7033772