Gene/Proteome Database (LMPD)

LMPD ID
LMP000044
Gene ID
Species
Mus musculus (Mouse)
Gene Name
annexin A11
Gene Symbol
Synonyms
A830099O17Rik; Anx11
Alternate Names
annexin A11; CAP-50; annexin XI; annexin-11; calcyclin-associated annexin 50; Annexin A11 (Annexin XI) (Calcyclin-associated annexin 50) (CAP-50)
Chromosome
14
Map Location
14 A3|14 15.06 cM

Proteins

annexin A11
Refseq ID NP_038497
Protein GI 160707921
UniProt ID P97384
mRNA ID NM_013469
Length 503
RefSeq Status VALIDATED
MSYPGYPPPAGGYPPAAPGGGPWGGAGYPPPSMPPIGLDNVANYAGQFNQDYLSGMAANMSGTFGGANVPNLYPGAPGGGYPPVPPGGFGQPPPAQQPVPPYGMYPPPGGNPPPGMPSYPAYPGAPVPGQPMPPTGQQPPGAYPGQPPMTYPGQSPMPPPGQQPVPSYPGYSGSSTITPAVPPAQFGNRGTITAASGFDPLRDAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDVYEIKEAIKGAGTDEACLIEIFASRSNEHIRELSRAYKTEFQKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLVQRDVQELYAAGENRLGTDESKFNAILCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEQGMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSELDLLDIRAEYKRMYGKSLYHDITGDTSGDYRKILLKICGGND

Gene Information

Entrez Gene ID
Gene Name
annexin A11
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0042582 IEA:Ensembl C azurophil granule
GO:0005737 IDA:MGI C cytoplasm
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0030496 ISS:UniProtKB C midbody
GO:0005634 IEA:UniProtKB-KW C nucleus
GO:0045335 IEA:Ensembl C phagocytic vesicle
GO:0042581 IEA:Ensembl C specific granule
GO:0005819 ISS:UniProtKB C spindle
GO:0044548 ISS:UniProtKB F S100 protein binding
GO:0005509 IDA:MGI F calcium ion binding
GO:0005544 IDA:MGI F calcium-dependent phospholipid binding
GO:0008429 IDA:MGI F phosphatidylethanolamine binding
GO:0044822 IEA:Ensembl F poly(A) RNA binding
GO:0007109 ISS:UniProtKB P cytokinesis, completion of separation
GO:0006909 IEA:Ensembl P phagocytosis
GO:0051592 IEA:Ensembl P response to calcium ion

Domain Information

InterPro Annotations

Accession Description
IPR001464 Annexin
IPR018252 Annexin repeat, conserved site
IPR008157 Annexin, type XI
IPR018502 Annexin_repeat

UniProt Annotations

Entry Information

Gene Name
annexin A11
Protein Entry
ANX11_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Domain A pair of annexin repeats may form one binding site for calcium and phospholipid.
Function Required for midbody formation and completion of the terminal phase of cytokinesis (By similarity). Binds specifically to calcyclin in a calcium-dependent manner. {ECO:0000250}.
Similarity Belongs to the annexin family. {ECO:0000305}.
Similarity Contains 4 annexin repeats. {ECO:0000305}.
Subcellular Location Cytoplasm {ECO:0000250}. Melanosome {ECO:0000250}. Nucleus envelope {ECO:0000250}. Nucleus, nucleoplasm {ECO:0000250}. Cytoplasm, cytoskeleton, spindle {ECO:0000250}. Note=Found throughout the nucleoplasm at interphase and during mitosis concentrates around the mitotic apparatus. Elevation of intracellular calcium causes relocalization from the nucleoplasm to the nuclear envelope, with little effect on the cytoplasmic pool. Localization to the nuclear envelope is cell- cycle dependent. {ECO:0000250}.
Subunit Interacts with S100A6. Interacts with PDCD6 in a calcium- dependent manner. Interacts with KIF23 during cytokinesis. {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP000044 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
160707921 RefSeq NP_038497 503 annexin A11

Identical Sequences to LMP000044 proteins

Reference Database Accession Length Protein Name
GI:160707921 DBBJ BAE24363.1 503 unnamed protein product [Mus musculus]
GI:160707921 EMBL CAJ18539.1 503 Anxa11 [Mus musculus]
GI:160707921 GenBank AAH12875.1 503 Annexin A11 [Mus musculus]
GI:160707921 GenBank EDL01415.1 503 annexin A11, isoform CRA_e [Mus musculus]
GI:160707921 RefSeq XP_006518514.1 503 PREDICTED: annexin A11 isoform X1 [Mus musculus]
GI:160707921 SwissProt P97384.2 503 RecName: Full=Annexin A11; AltName: Full=Annexin XI; AltName: Full=Annexin-11; AltName: Full=Calcyclin-associated annexin 50; Short=CAP-50 [Mus musculus]

Related Sequences to LMP000044 proteins

Reference Database Accession Length Protein Name
GI:160707921 EMBL CAB94770.1 503 annexin A11 [Mus musculus]
GI:160707921 GenBank AAB42012.1 503 annexin XI [Mus musculus]
GI:160707921 GenBank AAH83812.1 503 Annexin A11 [Rattus norvegicus]
GI:160707921 GenBank EDL75087.1 503 rCG39189, isoform CRA_a [Rattus norvegicus]
GI:160707921 RefSeq NP_001011918.1 503 annexin A11 [Rattus norvegicus]
GI:160707921 RefSeq XP_006991691.1 503 PREDICTED: annexin A11 [Peromyscus maniculatus bairdii]