Gene/Proteome Database (LMPD)
LMPD ID
LMP000044
Gene ID
Species
Mus musculus (Mouse)
Gene Name
annexin A11
Gene Symbol
Synonyms
A830099O17Rik; Anx11
Alternate Names
annexin A11; CAP-50; annexin XI; annexin-11; calcyclin-associated annexin 50; Annexin A11 (Annexin XI) (Calcyclin-associated annexin 50) (CAP-50)
Chromosome
14
Map Location
14 A3|14 15.06 cM
Proteins
annexin A11 | |
---|---|
Refseq ID | NP_038497 |
Protein GI | 160707921 |
UniProt ID | P97384 |
mRNA ID | NM_013469 |
Length | 503 |
RefSeq Status | VALIDATED |
MSYPGYPPPAGGYPPAAPGGGPWGGAGYPPPSMPPIGLDNVANYAGQFNQDYLSGMAANMSGTFGGANVPNLYPGAPGGGYPPVPPGGFGQPPPAQQPVPPYGMYPPPGGNPPPGMPSYPAYPGAPVPGQPMPPTGQQPPGAYPGQPPMTYPGQSPMPPPGQQPVPSYPGYSGSSTITPAVPPAQFGNRGTITAASGFDPLRDAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDVYEIKEAIKGAGTDEACLIEIFASRSNEHIRELSRAYKTEFQKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLVQRDVQELYAAGENRLGTDESKFNAILCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEQGMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSELDLLDIRAEYKRMYGKSLYHDITGDTSGDYRKILLKICGGND |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0042582 | IEA:Ensembl | C | azurophil granule |
GO:0005737 | IDA:MGI | C | cytoplasm |
GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
GO:0030496 | ISS:UniProtKB | C | midbody |
GO:0005634 | IEA:UniProtKB-KW | C | nucleus |
GO:0045335 | IEA:Ensembl | C | phagocytic vesicle |
GO:0042581 | IEA:Ensembl | C | specific granule |
GO:0005819 | ISS:UniProtKB | C | spindle |
GO:0044548 | ISS:UniProtKB | F | S100 protein binding |
GO:0005509 | IDA:MGI | F | calcium ion binding |
GO:0005544 | IDA:MGI | F | calcium-dependent phospholipid binding |
GO:0008429 | IDA:MGI | F | phosphatidylethanolamine binding |
GO:0044822 | IEA:Ensembl | F | poly(A) RNA binding |
GO:0007109 | ISS:UniProtKB | P | cytokinesis, completion of separation |
GO:0006909 | IEA:Ensembl | P | phagocytosis |
GO:0051592 | IEA:Ensembl | P | response to calcium ion |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Domain | A pair of annexin repeats may form one binding site for calcium and phospholipid. |
Function | Required for midbody formation and completion of the terminal phase of cytokinesis (By similarity). Binds specifically to calcyclin in a calcium-dependent manner. {ECO:0000250}. |
Similarity | Belongs to the annexin family. {ECO:0000305}. |
Similarity | Contains 4 annexin repeats. {ECO:0000305}. |
Subcellular Location | Cytoplasm {ECO:0000250}. Melanosome {ECO:0000250}. Nucleus envelope {ECO:0000250}. Nucleus, nucleoplasm {ECO:0000250}. Cytoplasm, cytoskeleton, spindle {ECO:0000250}. Note=Found throughout the nucleoplasm at interphase and during mitosis concentrates around the mitotic apparatus. Elevation of intracellular calcium causes relocalization from the nucleoplasm to the nuclear envelope, with little effect on the cytoplasmic pool. Localization to the nuclear envelope is cell- cycle dependent. {ECO:0000250}. |
Subunit | Interacts with S100A6. Interacts with PDCD6 in a calcium- dependent manner. Interacts with KIF23 during cytokinesis. {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000044 (as displayed in Record Overview)
Identical Sequences to LMP000044 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:160707921 | DBBJ | BAE24363.1 | 503 | unnamed protein product [Mus musculus] |
GI:160707921 | EMBL | CAJ18539.1 | 503 | Anxa11 [Mus musculus] |
GI:160707921 | GenBank | AAH12875.1 | 503 | Annexin A11 [Mus musculus] |
GI:160707921 | GenBank | EDL01415.1 | 503 | annexin A11, isoform CRA_e [Mus musculus] |
GI:160707921 | RefSeq | XP_006518514.1 | 503 | PREDICTED: annexin A11 isoform X1 [Mus musculus] |
GI:160707921 | SwissProt | P97384.2 | 503 | RecName: Full=Annexin A11; AltName: Full=Annexin XI; AltName: Full=Annexin-11; AltName: Full=Calcyclin-associated annexin 50; Short=CAP-50 [Mus musculus] |
Related Sequences to LMP000044 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:160707921 | EMBL | CAB94770.1 | 503 | annexin A11 [Mus musculus] |
GI:160707921 | GenBank | AAB42012.1 | 503 | annexin XI [Mus musculus] |
GI:160707921 | GenBank | AAH83812.1 | 503 | Annexin A11 [Rattus norvegicus] |
GI:160707921 | GenBank | EDL75087.1 | 503 | rCG39189, isoform CRA_a [Rattus norvegicus] |
GI:160707921 | RefSeq | NP_001011918.1 | 503 | annexin A11 [Rattus norvegicus] |
GI:160707921 | RefSeq | XP_006991691.1 | 503 | PREDICTED: annexin A11 [Peromyscus maniculatus bairdii] |