Gene/Proteome Database (LMPD)

LMPD ID
LMP000058
Gene ID
5947
Species
Homo sapiens (Human)
Gene Name
retinol binding protein 1, cellular
Gene Symbol
RBP1
Synonyms
CRABP-I; CRBP; CRBP1; CRBPI; RBPC
Alternate Names
retinol-binding protein 1; CRBP-I; cellular retinol-binding protein I; retinol-binding protein 1, cellular
Chromosome
3
Map Location
3q23
Summary
This gene encodes the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]
Orthologs
View orthologs and multiple alignments for RBP1

Proteins

retinol-binding protein 1 isoform a
Refseq ID NP_002890
Protein GI 195976807
UniProt ID P09455
mRNA ID NM_002899
Length 197
RefSeq Status REVIEWED
MDPPAGFVRAGNPAVAAPQSPLSPEGAHFRAAHHPRSTGSRCPGSLQPSRPLVANWLQSLPEMPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ
retinol-binding protein 1 isoform b
Refseq ID NP_001124464
Protein GI 195976809
UniProt ID P09455
mRNA ID NM_001130992
Length 157
RefSeq Status REVIEWED
MDPPAGFVRAGNPAVAAPQSPLSPEGAHFRAAHHPRSTGSRCPGSLQPSRPLVANWLQSLPEMPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMAGVQSRDLSSL
retinol-binding protein 1 isoform c
Refseq ID NP_001124465
Protein GI 195976811
UniProt ID P09455
mRNA ID NM_001130993
Length 153
RefSeq Status REVIEWED
MDPPAGFVRAGNPAVAAPQSPLSPEGAHFRAAHHPRSTGSRCPGSLQPSRPLVANWLQSLPEMPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMSETGFSS

Gene Information

Entrez Gene ID
5947
Gene Name
retinol binding protein 1, cellular
Gene Symbol
RBP1
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 TAS:Reactome C cytosol
GO:0016918 IEA:UniProtKB-KW F retinal binding
GO:0005501 TAS:ProtInc F retinoid binding
GO:0019841 IEA:UniProtKB-KW F retinol binding
GO:0005215 IEA:InterPro F transporter activity
GO:0007603 TAS:Reactome P phototransduction, visible light
GO:0001523 TAS:Reactome P retinoid metabolic process
GO:0006776 TAS:ProtInc P vitamin A metabolic process

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_24968 Retinoid metabolism and transport
REACT_160156 The canonical retinoid cycle in rods (twilight vision)

Domain Information

InterPro Annotations

Accession Description
IPR012674 Calycin
IPR011038 Calycin-like
IPR000463 Cytosolic fatty-acid binding
IPR000566 Lipocalin/cytosolic fatty-acid binding domain

UniProt Annotations

Entry Information

Gene Name
retinol binding protein 1, cellular
Protein Entry
RET1_HUMAN
UniProt ID
P09455
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P09455-1; Sequence=Displayed; Name=2; IsoId=P09455-2; Sequence=VSP_046201, VSP_046202; Note=No experimental confirmation available. Ref.3 (BAH13536) sequence is in conflict in position: 18:P->L. ; Name=3; IsoId=P09455-3; Sequence=VSP_046201, VSP_046203; Note=No experimental confirmation available.;
Domain Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior.
Function Intracellular transport of retinol.
Similarity Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Subcellular Location Cytoplasm.
Tissue Specificity Detected in nearly all the tissues with higher expression in adult ovary, pancreas, pituitary gland and adrenal gland, and fetal liver.

Identical and Related Proteins

Unique RefSeq proteins for LMP000058 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
195976807 RefSeq NP_002890 197 retinol-binding protein 1 isoform a
195976809 RefSeq NP_001124464 157 retinol-binding protein 1 isoform b
195976811 RefSeq NP_001124465 153 retinol-binding protein 1 isoform c

Identical Sequences to LMP000058 proteins

Reference Database Accession Length Protein Name
GI:195976807 GenBank EAW79035.1 197 retinol binding protein 1, cellular [Homo sapiens]

Related Sequences to LMP000058 proteins

Reference Database Accession Length Protein Name
GI:195976811 DBBJ BAH13536.1 153 unnamed protein product [Homo sapiens]
GI:195976811 GenBank EAW79035.1 197 retinol binding protein 1, cellular [Homo sapiens]
GI:195976809 GenBank EAW79035.1 197 retinol binding protein 1, cellular [Homo sapiens]
GI:195976811 RefSeq NP_002890.2 197 retinol-binding protein 1 isoform a [Homo sapiens]
GI:195976809 RefSeq NP_002890.2 197 retinol-binding protein 1 isoform a [Homo sapiens]
GI:195976811 RefSeq NP_001124464.1 157 retinol-binding protein 1 isoform b [Homo sapiens]
GI:195976809 RefSeq NP_001124465.1 153 retinol-binding protein 1 isoform c [Homo sapiens]
GI:195976807 RefSeq XP_001113466.2 542 PREDICTED: hypothetical protein LOC715667 [Macaca mulatta]
GI:195976809 RefSeq XP_003310069.1 157 PREDICTED: retinol-binding protein 1 isoform X2 [Pan troglodytes]
GI:195976811 RefSeq XP_003826581.1 153 PREDICTED: retinol-binding protein 1 isoform X3 [Pan paniscus]
GI:195976809 RefSeq XP_003826582.1 157 PREDICTED: retinol-binding protein 1 isoform X2 [Pan paniscus]
GI:195976807 RefSeq XP_004037795.1 197 PREDICTED: retinol-binding protein 1 isoform 1 [Gorilla gorilla gorilla]
GI:195976811 RefSeq XP_004037796.1 153 PREDICTED: retinol-binding protein 1 isoform 2 [Gorilla gorilla gorilla]
GI:195976809 RefSeq XP_004037797.1 157 PREDICTED: retinol-binding protein 1 isoform 3 [Gorilla gorilla gorilla]
GI:195976807 RefSeq XP_008007114.1 197 PREDICTED: LOW QUALITY PROTEIN: retinol-binding protein 1 [Chlorocebus sabaeus]
GI:195976807 RefSeq XP_008950187.1 197 PREDICTED: retinol-binding protein 1 isoform X1 [Pan paniscus]
GI:195976807 RefSeq XP_002814149.3 197 PREDICTED: LOW QUALITY PROTEIN: retinol-binding protein 1 [Pongo abelii]
GI:195976807 RefSeq XP_009444839.1 197 PREDICTED: retinol-binding protein 1 isoform X1 [Pan troglodytes]