Gene/Proteome Database (LMPD)
LMPD ID
LMP000058
Gene ID
Species
Homo sapiens (Human)
Gene Name
retinol binding protein 1, cellular
Gene Symbol
Synonyms
CRABP-I; CRBP; CRBP1; CRBPI; RBPC
Alternate Names
retinol-binding protein 1; CRBP-I; cellular retinol-binding protein I; retinol-binding protein 1, cellular
Chromosome
3
Map Location
3q23
Summary
This gene encodes the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]
Orthologs
Proteins
| retinol-binding protein 1 isoform a | |
|---|---|
| Refseq ID | NP_002890 |
| Protein GI | 195976807 |
| UniProt ID | P09455 |
| mRNA ID | NM_002899 |
| Length | 197 |
| RefSeq Status | REVIEWED |
| MDPPAGFVRAGNPAVAAPQSPLSPEGAHFRAAHHPRSTGSRCPGSLQPSRPLVANWLQSLPEMPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ | |
| retinol-binding protein 1 isoform b | |
|---|---|
| Refseq ID | NP_001124464 |
| Protein GI | 195976809 |
| UniProt ID | P09455 |
| mRNA ID | NM_001130992 |
| Length | 157 |
| RefSeq Status | REVIEWED |
| MDPPAGFVRAGNPAVAAPQSPLSPEGAHFRAAHHPRSTGSRCPGSLQPSRPLVANWLQSLPEMPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMAGVQSRDLSSL | |
| retinol-binding protein 1 isoform c | |
|---|---|
| Refseq ID | NP_001124465 |
| Protein GI | 195976811 |
| UniProt ID | P09455 |
| mRNA ID | NM_001130993 |
| Length | 153 |
| RefSeq Status | REVIEWED |
| MDPPAGFVRAGNPAVAAPQSPLSPEGAHFRAAHHPRSTGSRCPGSLQPSRPLVANWLQSLPEMPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMSETGFSS | |
Gene Information
Entrez Gene ID
Gene Name
retinol binding protein 1, cellular
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005829 | TAS:Reactome | C | cytosol |
| GO:0016918 | IEA:UniProtKB-KW | F | retinal binding |
| GO:0005501 | TAS:ProtInc | F | retinoid binding |
| GO:0019841 | IEA:UniProtKB-KW | F | retinol binding |
| GO:0005215 | IEA:InterPro | F | transporter activity |
| GO:0007603 | TAS:Reactome | P | phototransduction, visible light |
| GO:0001523 | TAS:Reactome | P | retinoid metabolic process |
| GO:0006776 | TAS:ProtInc | P | vitamin A metabolic process |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_24968 | Retinoid metabolism and transport |
| REACT_160156 | The canonical retinoid cycle in rods (twilight vision) |
Domain Information
UniProt Annotations
Entry Information
Gene Name
retinol binding protein 1, cellular
Protein Entry
RET1_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P09455-1; Sequence=Displayed; Name=2; IsoId=P09455-2; Sequence=VSP_046201, VSP_046202; Note=No experimental confirmation available. Ref.3 (BAH13536) sequence is in conflict in position: 18:P->L. ; Name=3; IsoId=P09455-3; Sequence=VSP_046201, VSP_046203; Note=No experimental confirmation available.; |
| Domain | Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior. |
| Function | Intracellular transport of retinol. |
| Similarity | Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. |
| Subcellular Location | Cytoplasm. |
| Tissue Specificity | Detected in nearly all the tissues with higher expression in adult ovary, pancreas, pituitary gland and adrenal gland, and fetal liver. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000058 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 195976807 | RefSeq | NP_002890 | 197 | retinol-binding protein 1 isoform a |
| 195976809 | RefSeq | NP_001124464 | 157 | retinol-binding protein 1 isoform b |
| 195976811 | RefSeq | NP_001124465 | 153 | retinol-binding protein 1 isoform c |
Identical Sequences to LMP000058 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:195976807 | GenBank | EAW79035.1 | 197 | retinol binding protein 1, cellular [Homo sapiens] |
Related Sequences to LMP000058 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:195976811 | DBBJ | BAH13536.1 | 153 | unnamed protein product [Homo sapiens] |
| GI:195976811 | GenBank | EAW79035.1 | 197 | retinol binding protein 1, cellular [Homo sapiens] |
| GI:195976809 | GenBank | EAW79035.1 | 197 | retinol binding protein 1, cellular [Homo sapiens] |
| GI:195976811 | RefSeq | NP_002890.2 | 197 | retinol-binding protein 1 isoform a [Homo sapiens] |
| GI:195976809 | RefSeq | NP_002890.2 | 197 | retinol-binding protein 1 isoform a [Homo sapiens] |
| GI:195976811 | RefSeq | NP_001124464.1 | 157 | retinol-binding protein 1 isoform b [Homo sapiens] |
| GI:195976809 | RefSeq | NP_001124465.1 | 153 | retinol-binding protein 1 isoform c [Homo sapiens] |
| GI:195976807 | RefSeq | XP_001113466.2 | 542 | PREDICTED: hypothetical protein LOC715667 [Macaca mulatta] |
| GI:195976809 | RefSeq | XP_003310069.1 | 157 | PREDICTED: retinol-binding protein 1 isoform X2 [Pan troglodytes] |
| GI:195976811 | RefSeq | XP_003826581.1 | 153 | PREDICTED: retinol-binding protein 1 isoform X3 [Pan paniscus] |
| GI:195976809 | RefSeq | XP_003826582.1 | 157 | PREDICTED: retinol-binding protein 1 isoform X2 [Pan paniscus] |
| GI:195976807 | RefSeq | XP_004037795.1 | 197 | PREDICTED: retinol-binding protein 1 isoform 1 [Gorilla gorilla gorilla] |
| GI:195976811 | RefSeq | XP_004037796.1 | 153 | PREDICTED: retinol-binding protein 1 isoform 2 [Gorilla gorilla gorilla] |
| GI:195976809 | RefSeq | XP_004037797.1 | 157 | PREDICTED: retinol-binding protein 1 isoform 3 [Gorilla gorilla gorilla] |
| GI:195976807 | RefSeq | XP_008007114.1 | 197 | PREDICTED: LOW QUALITY PROTEIN: retinol-binding protein 1 [Chlorocebus sabaeus] |
| GI:195976807 | RefSeq | XP_008950187.1 | 197 | PREDICTED: retinol-binding protein 1 isoform X1 [Pan paniscus] |
| GI:195976807 | RefSeq | XP_002814149.3 | 197 | PREDICTED: LOW QUALITY PROTEIN: retinol-binding protein 1 [Pongo abelii] |
| GI:195976807 | RefSeq | XP_009444839.1 | 197 | PREDICTED: retinol-binding protein 1 isoform X1 [Pan troglodytes] |