Gene/Proteome Database (LMPD)

LMPD ID
LMP000070
Gene ID
Species
Mus musculus (Mouse)
Gene Name
malonyl CoA:ACP acyltransferase (mitochondrial)
Gene Symbol
Synonyms
AI225907; BC025519
Alternate Names
malonyl-CoA-acyl carrier protein transacylase, mitochondrial; MCT; mitochondrial malonyltransferase; [Acyl-carrier-protein] malonyltransferase; malonyl CoA-acyl carrier protein transacylase, mitochondrial
Chromosome
15
Map Location
15 E1|15
EC Number
2.3.1.39

Proteins

malonyl-CoA-acyl carrier protein transacylase, mitochondrial
Refseq ID NP_001025185
Protein GI 71725343
UniProt ID Q8R3F5
mRNA ID NM_001030014
Length 381
RefSeq Status PROVISIONAL
MSARVARAGWAWRSWGRRAASSLREPPPDAVDVAELLRDSSVAEEGAQEAVARRRPPSQCSVLLFPGQGCQAVGMGSGLLHLPRVRQLYEAAHRVLGYDLLELCLRGPQEDLDRTVHCQPAVFVASLAAVEKLHHLQPAVIDNCVAAAGFSVGEFAALVFAGAMDFSEGLYAVKARAEAMQEASEAVPSGMLSVLGQRQSNFSFACLEAQEHCKSLGIENPVCQVSNYLFPDCRVISGHLEALQFLRRNSAKYHFRRTKMLPVSGGFHTCLMEPAVDPLMKVLGSINIKKPLVAVHSNVSGQKYTHPQHIRKLLGQQVVSPVKWEQTMHSIYERKKGMEFPSTYEVGPGQQLGSILKCCNRQAWKSYSHVDVMQNIMDPDP

Gene Information

Entrez Gene ID
Gene Name
malonyl CoA:ACP acyltransferase (mitochondrial)
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005739 IDA:MGI C mitochondrion
GO:0004314 IEA:UniProtKB-EC F [acyl-carrier-protein] S-malonyltransferase activity
GO:0044822 IEA:Ensembl F poly(A) RNA binding
GO:0006633 IEA:UniProtKB-UniPathway P fatty acid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
mmu00061 Fatty acid biosynthesis
mmu01212 Fatty acid metabolism
mmu01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR014043 Acyl transferase
IPR001227 Acyl transferase domain
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding

UniProt Annotations

Entry Information

Gene Name
malonyl CoA:ACP acyltransferase (mitochondrial)
Protein Entry
FABD_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Catalytic Activity Malonyl-CoA + an [acyl-carrier-protein] = CoA + a malonyl-[acyl-carrier-protein].
Function Catalyzes the transfer of a malonyl moiety from malonyl- CoA to the free thiol group of the phosphopantetheine arm of the mitochondrial ACP protein (NDUFAB1). This suggests the existence of the biosynthesis of fatty acids in mitochondrias (By similarity). {ECO:0000250}.
Pathway Lipid metabolism; fatty acid biosynthesis.
Sequence Caution Sequence=AAH25519.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Similarity Belongs to the type II malonyltransferase family. {ECO:0000305}.
Subcellular Location Mitochondrion {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP000070 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
71725343 RefSeq NP_001025185 381 malonyl-CoA-acyl carrier protein transacylase, mitochondrial

Identical Sequences to LMP000070 proteins

Reference Database Accession Length Protein Name
GI:71725343 GenBank AAH99494.1 381 Malonyl CoA:ACP acyltransferase (mitochondrial) [Mus musculus]
GI:71725343 SwissProt Q8R3F5.3 381 RecName: Full=Malonyl-CoA-acyl carrier protein transacylase, mitochondrial; Short=MCT; AltName: Full=Mitochondrial malonyltransferase; AltName: Full=[Acyl-carrier-protein] malonyltransferase; Flags: Precursor [Mus musculus]

Related Sequences to LMP000070 proteins

Reference Database Accession Length Protein Name
GI:71725343 GenBank ERE86516.1 384 malonyl-CoA-acyl carrier protein transacylase [Cricetulus griseus]
GI:71725343 RefSeq NP_001178717.1 380 malonyl-CoA-acyl carrier protein transacylase, mitochondrial [Rattus norvegicus]
GI:71725343 RefSeq XP_005067102.1 384 PREDICTED: malonyl-CoA-acyl carrier protein transacylase, mitochondrial [Mesocricetus auratus]
GI:71725343 RefSeq XP_005354495.1 380 PREDICTED: malonyl-CoA-acyl carrier protein transacylase, mitochondrial [Microtus ochrogaster]
GI:71725343 RefSeq XP_006242153.1 380 PREDICTED: malonyl-CoA-acyl carrier protein transacylase, mitochondrial isoform X1 [Rattus norvegicus]
GI:71725343 RefSeq XP_006980306.1 380 PREDICTED: malonyl-CoA-acyl carrier protein transacylase, mitochondrial isoform X1 [Peromyscus maniculatus bairdii]