Gene/Proteome Database (LMPD)
LMPD ID
LMP000070
Gene ID
Species
Mus musculus (Mouse)
Gene Name
malonyl CoA:ACP acyltransferase (mitochondrial)
Gene Symbol
Synonyms
AI225907; BC025519
Alternate Names
malonyl-CoA-acyl carrier protein transacylase, mitochondrial; MCT; mitochondrial malonyltransferase; [Acyl-carrier-protein] malonyltransferase; malonyl CoA-acyl carrier protein transacylase, mitochondrial
Chromosome
15
Map Location
15 E1|15
EC Number
2.3.1.39
Proteins
malonyl-CoA-acyl carrier protein transacylase, mitochondrial | |
---|---|
Refseq ID | NP_001025185 |
Protein GI | 71725343 |
UniProt ID | Q8R3F5 |
mRNA ID | NM_001030014 |
Length | 381 |
RefSeq Status | PROVISIONAL |
MSARVARAGWAWRSWGRRAASSLREPPPDAVDVAELLRDSSVAEEGAQEAVARRRPPSQCSVLLFPGQGCQAVGMGSGLLHLPRVRQLYEAAHRVLGYDLLELCLRGPQEDLDRTVHCQPAVFVASLAAVEKLHHLQPAVIDNCVAAAGFSVGEFAALVFAGAMDFSEGLYAVKARAEAMQEASEAVPSGMLSVLGQRQSNFSFACLEAQEHCKSLGIENPVCQVSNYLFPDCRVISGHLEALQFLRRNSAKYHFRRTKMLPVSGGFHTCLMEPAVDPLMKVLGSINIKKPLVAVHSNVSGQKYTHPQHIRKLLGQQVVSPVKWEQTMHSIYERKKGMEFPSTYEVGPGQQLGSILKCCNRQAWKSYSHVDVMQNIMDPDP |
Gene Information
Entrez Gene ID
Gene Name
malonyl CoA:ACP acyltransferase (mitochondrial)
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005739 | IDA:MGI | C | mitochondrion |
GO:0004314 | IEA:UniProtKB-EC | F | [acyl-carrier-protein] S-malonyltransferase activity |
GO:0044822 | IEA:Ensembl | F | poly(A) RNA binding |
GO:0006633 | IEA:UniProtKB-UniPathway | P | fatty acid biosynthetic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
malonyl CoA:ACP acyltransferase (mitochondrial)
Protein Entry
FABD_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Malonyl-CoA + an [acyl-carrier-protein] = CoA + a malonyl-[acyl-carrier-protein]. |
Function | Catalyzes the transfer of a malonyl moiety from malonyl- CoA to the free thiol group of the phosphopantetheine arm of the mitochondrial ACP protein (NDUFAB1). This suggests the existence of the biosynthesis of fatty acids in mitochondrias (By similarity). {ECO:0000250}. |
Pathway | Lipid metabolism; fatty acid biosynthesis. |
Sequence Caution | Sequence=AAH25519.1; Type=Erroneous initiation; Evidence={ECO:0000305}; |
Similarity | Belongs to the type II malonyltransferase family. {ECO:0000305}. |
Subcellular Location | Mitochondrion {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000070 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
71725343 | RefSeq | NP_001025185 | 381 | malonyl-CoA-acyl carrier protein transacylase, mitochondrial |
Identical Sequences to LMP000070 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:71725343 | GenBank | AAH99494.1 | 381 | Malonyl CoA:ACP acyltransferase (mitochondrial) [Mus musculus] |
GI:71725343 | SwissProt | Q8R3F5.3 | 381 | RecName: Full=Malonyl-CoA-acyl carrier protein transacylase, mitochondrial; Short=MCT; AltName: Full=Mitochondrial malonyltransferase; AltName: Full=[Acyl-carrier-protein] malonyltransferase; Flags: Precursor [Mus musculus] |
Related Sequences to LMP000070 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:71725343 | GenBank | ERE86516.1 | 384 | malonyl-CoA-acyl carrier protein transacylase [Cricetulus griseus] |
GI:71725343 | RefSeq | NP_001178717.1 | 380 | malonyl-CoA-acyl carrier protein transacylase, mitochondrial [Rattus norvegicus] |
GI:71725343 | RefSeq | XP_005067102.1 | 384 | PREDICTED: malonyl-CoA-acyl carrier protein transacylase, mitochondrial [Mesocricetus auratus] |
GI:71725343 | RefSeq | XP_005354495.1 | 380 | PREDICTED: malonyl-CoA-acyl carrier protein transacylase, mitochondrial [Microtus ochrogaster] |
GI:71725343 | RefSeq | XP_006242153.1 | 380 | PREDICTED: malonyl-CoA-acyl carrier protein transacylase, mitochondrial isoform X1 [Rattus norvegicus] |
GI:71725343 | RefSeq | XP_006980306.1 | 380 | PREDICTED: malonyl-CoA-acyl carrier protein transacylase, mitochondrial isoform X1 [Peromyscus maniculatus bairdii] |