Gene/Proteome Database (LMPD)
Proteins
| acyl carrier protein, mitochondrial precursor | |
|---|---|
| Refseq ID | NP_082453 |
| Protein GI | 27754007 |
| UniProt ID | Q569N0 |
| mRNA ID | NM_028177 |
| Length | 156 |
| RefSeq Status | PROVISIONAL |
| MASRVLCACVRRLPAAFAPLPRLPTLALARPLSTTLCPEGIRRRPGALQSALALAQVPGTVTHLCRQYSDAPPLTLDGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE | |
| transit_peptide: 1..68 inference: non-experimental evidence, no additional details recorded note: Mitochondrion (By similarity); propagated from UniProtKB/Swiss-Prot (Q9CR21.1) calculated_mol_wt: 7293 peptide sequence: MASRVLCACVRRLPAAFAPLPRLPTLALARPLSTTLCPEGIRRRPGALQSALALAQVPGTVTHLCRQY mat_peptide: 69..156 product: Acyl carrier protein, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q9CR21.1) calculated_mol_wt: 10096 peptide sequence: SDAPPLTLDGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE | |
Gene Information
Entrez Gene ID
Gene Name
NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005739 | IDA:MGI | C | mitochondrion |
| GO:0006633 | IEA:UniProtKB-KW | P | fatty acid biosynthetic process |
| GO:0009249 | IEA:Ensembl | P | protein lipoylation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1
Protein Entry
ACPM_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Function | Carrier of the growing fatty acid chain in fatty acid biosynthesis. |
| Similarity | Contains 1 acyl carrier domain. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000086 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 27754007 | RefSeq | NP_082453 | 156 | acyl carrier protein, mitochondrial precursor |
Identical Sequences to LMP000086 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:27754007 | DBBJ | BAE30638.1 | 156 | unnamed protein product [Mus musculus] |
| GI:27754007 | DBBJ | BAE31638.1 | 156 | unnamed protein product [Mus musculus] |
| GI:27754007 | GenBank | AAH60951.1 | 156 | Ndufab1 protein [Mus musculus] |
| GI:27754007 | GenBank | AAH92379.1 | 156 | Ndufab1 protein [Mus musculus] |
| GI:27754007 | GenBank | EDL17264.1 | 156 | NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, isoform CRA_b [Mus musculus] |
| GI:27754007 | RefSeq | XP_006508263.1 | 156 | PREDICTED: acyl carrier protein, mitochondrial isoform X1 [Mus musculus] |
Related Sequences to LMP000086 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:27754007 | DBBJ | BAB26446.1 | 156 | unnamed protein product [Mus musculus] |
| GI:27754007 | DBBJ | BAE39533.1 | 156 | unnamed protein product [Mus musculus] |
| GI:27754007 | GenBank | EDM17569.1 | 156 | NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1 (predicted), isoform CRA_a [Rattus norvegicus] |
| GI:27754007 | RefSeq | NP_001099764.1 | 156 | acyl carrier protein, mitochondrial [Rattus norvegicus] |
| GI:27754007 | RefSeq | XP_006544275.1 | 163 | PREDICTED: acyl carrier protein, mitochondrial-like, partial [Mus musculus] |
| GI:27754007 | RefSeq | XP_006541434.1 | 163 | PREDICTED: acyl carrier protein, mitochondrial-like, partial [Mus musculus] |