Gene/Proteome Database (LMPD)
Proteins
| apolipoprotein C-IV precursor | |
|---|---|
| Refseq ID | NP_031411 |
| Protein GI | 6671501 |
| UniProt ID | Q61268 |
| mRNA ID | NM_007385 |
| Length | 124 |
| RefSeq Status | VALIDATED |
| MSLLRCRPRDLPSVSLSVLFLVSFVASMSTESLSPTPGPESSRWSLVRARVLEMVEPLVTRTRDRWQWFWGPGAVQGFMQTYYEDHLKDLGPRTQAWLQSSRDHLLNKTHSLCPRLLCKDRTQG | |
| sig_peptide: 1..27 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2994 peptide sequence: MSLLRCRPRDLPSVSLSVLFLVSFVAS mat_peptide: 28..124 product: Apolipoprotein C-IV experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q61268.1) calculated_mol_wt: 11313 peptide sequence: MSTESLSPTPGPESSRWSLVRARVLEMVEPLVTRTRDRWQWFWGPGAVQGFMQTYYEDHLKDLGPRTQAWLQSSRDHLLNKTHSLCPRLLCKDRTQG | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0034364 | IEA:Ensembl | C | high-density lipoprotein particle |
| GO:0034361 | IDA:BHF-UCL | C | very-low-density lipoprotein particle |
| GO:0006869 | IEA:UniProtKB-KW | P | lipid transport |
| GO:0010890 | IEA:Ensembl | P | positive regulation of sequestering of triglyceride |
| GO:0070328 | IEA:Ensembl | P | triglyceride homeostasis |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR028120 | Apolipoprotein C-IV |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | May participate in lipoprotein metabolism. |
| Similarity | Belongs to the apolipoprotein C4 family. {ECO:0000305}. |
| Subcellular Location | Secreted. |
| Tissue Specificity | Expressed by the liver and secreted in plasma. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000097 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 6671501 | RefSeq | NP_031411 | 124 | apolipoprotein C-IV precursor |
Identical Sequences to LMP000097 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6671501 | EMBL | CAA80850.1 | 124 | ACL [Mus musculus] |
| GI:6671501 | GenBank | AAH24657.1 | 124 | Apolipoprotein C-IV [Mus musculus] |
| GI:6671501 | GenBank | EDL23172.1 | 124 | apolipoprotein C-IV [Mus musculus] |
| GI:6671501 | SwissProt | Q61268.1 | 124 | RecName: Full=Apolipoprotein C-IV; Short=Apo-CIV; Short=ApoC-IV; AltName: Full=Apolipoprotein C2-linked; Short=ACL; AltName: Full=Apolipoprotein C4; Flags: Precursor [Mus musculus] |
Related Sequences to LMP000097 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6671501 | GenBank | EDM08173.1 | 124 | rCG54131 [Rattus norvegicus] |
| GI:6671501 | RefSeq | NP_001102889.1 | 124 | apolipoprotein C-IV precursor [Rattus norvegicus] |
| GI:6671501 | RefSeq | XP_005086376.1 | 124 | PREDICTED: apolipoprotein C-IV [Mesocricetus auratus] |
| GI:6671501 | RefSeq | XP_005370363.1 | 124 | PREDICTED: apolipoprotein C-IV-like isoform X2 [Microtus ochrogaster] |
| GI:6671501 | RefSeq | XP_007607587.1 | 124 | PREDICTED: apolipoprotein C-IV [Cricetulus griseus] |
| GI:6671501 | SwissProt | P55797.2 | 124 | RecName: Full=Apolipoprotein C-IV; Short=Apo-CIV; Short=ApoC-IV; AltName: Full=Apolipoprotein C4; AltName: Full=Apolipoprotein E-linked; AltName: Full=ECL; Flags: Precursor [Rattus norvegicus] |