Gene/Proteome Database (LMPD)
LMPD ID
LMP000116
Gene ID
Species
Mus musculus (Mouse)
Gene Name
nuclear receptor subfamily 5, group A, member 2
Gene Symbol
Synonyms
AU020803; D1Ertd308e; Ftf; LRH-1; UF2-H3B
Alternate Names
nuclear receptor subfamily 5 group A member 2; liver receptor homolog 1; fetoprotein transcription factor
Chromosome
1
Map Location
1 E4|1 59.98 cM
Proteins
nuclear receptor subfamily 5 group A member 2 isoform 1 | |
---|---|
Refseq ID | NP_109601 |
Protein GI | 14010847 |
UniProt ID | P45448 |
mRNA ID | NM_030676 |
Length | 560 |
RefSeq Status | VALIDATED |
MSASLDTGDFQEFLKHGLTAIASAPGSETRHSPKREEQLREKRAGLPDRHRRPIPARSRLVMLPKVETEAPGLVRSHGEQGQMPENMQVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNQKRYTCIENQNCQIDKTQRKRCPYCRFKKCIDVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMSQVIQAMPSDLTSAIQNIHSASKGLPLSHVALPPTDYDRSPFVTSPISMTMPPHSSLHGYQPYGHFPSRAIKSEYPDPYSSSPESMMGYSYMDGYQTNSPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQSNRNRQEKLSAFGLLCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVAHGKEGTIFLVTGEHVDYSTIISHTEVAFNNLLSLAQELVVRLRSLQFDQREFVCLKFLVLFSSDVKNLENLQLVEGVQEQVNAALLDYTVCNYPQQTEKFGQLLLRLPEIRAISKQAEDYLYYKHVNGDVPYNNLLIEMLHAKRA |
nuclear receptor subfamily 5 group A member 2 isoform 2 | |
---|---|
Refseq ID | NP_001153241 |
Protein GI | 229335598 |
UniProt ID | Q1WLP7 |
mRNA ID | NM_001159769 |
Length | 499 |
RefSeq Status | VALIDATED |
MLPKVETEAPGLVRSHGEQGQMPENMQVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNQKRYTCIENQNCQIDKTQRKRCPYCRFKKCIDVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMSQVIQAMPSDLTSAIQNIHSASKGLPLSHVALPPTDYDRSPFVTSPISMTMPPHSSLHGYQPYGHFPSRAIKSEYPDPYSSSPESMMGYSYMDGYQTNSPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQSNRNRQEKLSAFGLLCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVAHGKEGTIFLVTGEHVDYSTIISHTEVAFNNLLSLAQELVVRLRSLQFDQREFVCLKFLVLFSSDVKNLENLQLVEGVQEQVNAALLDYTVCNYPQQTEKFGQLLLRLPEIRAISKQAEDYLYYKHVNGDVPYNNLLIEMLHAKRA |
Gene Information
Entrez Gene ID
Gene Name
nuclear receptor subfamily 5, group A, member 2
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005829 | TAS:Reactome | C | cytosol |
GO:0005634 | IDA:MGI | C | nucleus |
GO:0003677 | IDA:MGI | F | DNA binding |
GO:0000978 | IDA:NTNU_SB | F | RNA polymerase II core promoter proximal region sequence-specific DNA binding |
GO:0001077 | IDA:NTNU_SB | F | RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription |
GO:0005543 | IEA:Ensembl | F | phospholipid binding |
GO:0003700 | ISS:UniProtKB | F | sequence-specific DNA binding transcription factor activity |
GO:0003707 | IEA:InterPro | F | steroid hormone receptor activity |
GO:0008270 | IEA:InterPro | F | zinc ion binding |
GO:0008206 | IMP:MGI | P | bile acid metabolic process |
GO:0042632 | IMP:MGI | P | cholesterol homeostasis |
GO:0031018 | TAS:Reactome | P | endocrine pancreas development |
GO:0045944 | IDA:NTNU_SB | P | positive regulation of transcription from RNA polymerase II promoter |
GO:0045070 | IEA:Ensembl | P | positive regulation of viral genome replication |
GO:0042127 | IGI:MGI | P | regulation of cell proliferation |
GO:0006355 | ISS:UniProtKB | P | regulation of transcription, DNA-templated |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
mmu04950 | Maturity onset diabetes of the young |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
5893581 | Regulation of gene expression in early pancreatic precursor cells |
Domain Information
InterPro Annotations
UniProt Annotations
Entry Information
Gene Name
nuclear receptor subfamily 5, group A, member 2
Protein Entry
Q1WLP7_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Function | Binds to promoters containing the sequence element 5'- AACGACCGACCTTGAG-3'. Plays a role in the regulation of gene expression in liver and pancreas. May play a role in embryonic development (By similarity). {ECO:0000250}. |
Similarity | Belongs to the nuclear hormone receptor family. NR5 subfamily. {ECO:0000305}. |
Similarity | Contains 1 nuclear receptor DNA-binding domain. {ECO:0000255|PROSITE-ProRule:PRU00407}. |
Subcellular Location | Nucleus {ECO:0000305}. |
Subunit | Binds DNA as a monomer (By similarity). Interacts with GRIP1, NCOA2 and NR0B2. {ECO:0000250, ECO:0000269|PubMed:12820970, ECO:0000269|PubMed:15976031}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000116 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
14010847 | RefSeq | NP_109601 | 560 | nuclear receptor subfamily 5 group A member 2 isoform 1 |
229335598 | RefSeq | NP_001153241 | 499 | nuclear receptor subfamily 5 group A member 2 isoform 2 |
Identical Sequences to LMP000116 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:14010847 | GenBank | AAA39447.1 | 560 | liver receptor homologue [Mus musculus] |
GI:14010847 | GenBank | AAE28147.1 | 560 | Sequence 10 from patent US 5958697 |
GI:14010847 | GenBank | AAE82740.1 | 560 | Sequence 10 from patent US 6297019 |
GI:229335598 | GenBank | AAZ99450.1 | 499 | liver receptor-like protein 1 variant 2 [Mus musculus] |
GI:14010847 | GenBank | AAI37846.1 | 560 | Nuclear receptor subfamily 5, group A, member 2 [Mus musculus] |
GI:229335598 | RefSeq | XP_006529685.1 | 499 | PREDICTED: nuclear receptor subfamily 5 group A member 2 isoform X3 [Mus musculus] |
GI:14010847 | SwissProt | P45448.3 | 560 | RecName: Full=Nuclear receptor subfamily 5 group A member 2; AltName: Full=Liver receptor homolog 1; Short=LRH-1 [Mus musculus] |
Related Sequences to LMP000116 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:14010847 | DBBJ | BAA36339.1 | 560 | FTZ-F1 beta1 [Rattus norvegicus] |
GI:229335598 | GenBank | AAA39447.1 | 560 | liver receptor homologue [Mus musculus] |
GI:229335598 | GenBank | AAE28147.1 | 560 | Sequence 10 from patent US 5958697 |
GI:229335598 | GenBank | AAE82740.1 | 560 | Sequence 10 from patent US 6297019 |
GI:14010847 | GenBank | EDM09652.1 | 539 | nuclear receptor subfamily 5, group A, member 2, isoform CRA_c [Rattus norvegicus] |
GI:229335598 | GenBank | AAI37846.1 | 560 | Nuclear receptor subfamily 5, group A, member 2 [Mus musculus] |
GI:14010847 | RefSeq | NP_068510.1 | 560 | nuclear receptor subfamily 5 group A member 2 [Rattus norvegicus] |
GI:229335598 | RefSeq | NP_109601.1 | 560 | nuclear receptor subfamily 5 group A member 2 isoform 1 [Mus musculus] |
GI:14010847 | RefSeq | XP_006529683.1 | 552 | PREDICTED: nuclear receptor subfamily 5 group A member 2 isoform X1 [Mus musculus] |
GI:14010847 | RefSeq | XP_006529684.1 | 539 | PREDICTED: nuclear receptor subfamily 5 group A member 2 isoform X2 [Mus musculus] |
GI:229335598 | SwissProt | P45448.3 | 560 | RecName: Full=Nuclear receptor subfamily 5 group A member 2; AltName: Full=Liver receptor homolog 1; Short=LRH-1 [Mus musculus] |
GI:14010847 | SwissProt | Q9QWM1.1 | 560 | RecName: Full=Nuclear receptor subfamily 5 group A member 2; AltName: Full=FTZ-F1 beta; AltName: Full=Liver receptor homolog 1; Short=LRH-1 [Rattus norvegicus] |