Gene/Proteome Database (LMPD)
Proteins
| cytohesin-3 isoform 1 | |
|---|---|
| Refseq ID | NP_035312 |
| Protein GI | 254750656 |
| UniProt ID | Q3TXK1 |
| mRNA ID | NM_011182 |
| Length | 399 |
| RefSeq Status | VALIDATED |
| MDEGGGGEGGSVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEESKTTQRNKQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLGERDDFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNPGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFITMNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK | |
| cytohesin-3 isoform 2 | |
|---|---|
| Refseq ID | NP_001157020 |
| Protein GI | 254750658 |
| UniProt ID | Q3TXK1 |
| mRNA ID | NM_001163548 |
| Length | 351 |
| RefSeq Status | VALIDATED |
| MTEIDNLTSVEESKTTQRNKQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLGERDDFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNPGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFITMNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IDA:MGI | C | cytoplasm |
| GO:0005829 | IEA:Ensembl | C | cytosol |
| GO:0031234 | IEA:Ensembl | C | extrinsic component of cytoplasmic side of plasma membrane |
| GO:0005886 | IDA:MGI | C | plasma membrane |
| GO:0001726 | IPI:MGI | C | ruffle |
| GO:0005086 | IBA:RefGenome | F | ARF guanyl-nucleotide exchange factor activity |
| GO:0005085 | ISS:MGI | F | guanyl-nucleotide exchange factor activity |
| GO:0005547 | IDA:MGI | F | phosphatidylinositol-3,4,5-trisphosphate binding |
| GO:0048193 | IEA:Ensembl | P | Golgi vesicle transport |
| GO:0090162 | IMP:MGI | P | establishment of epithelial cell polarity |
| GO:0043547 | IBA:GOC | P | positive regulation of GTPase activity |
| GO:0045785 | IDA:MGI | P | positive regulation of cell adhesion |
| GO:0032012 | IEA:InterPro | P | regulation of ARF protein signal transduction |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Similarity | Contains 1 PH domain. |
| Similarity | Contains SEC7 domain. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000120 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 254750656 | RefSeq | NP_035312 | 399 | cytohesin-3 isoform 1 |
| 254750658 | RefSeq | NP_001157020 | 351 | cytohesin-3 isoform 2 |
Identical Sequences to LMP000120 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:254750656 | GenBank | EDL89657.1 | 399 | pleckstrin homology, Sec7 and coiled-coil domains 3, isoform CRA_b [Rattus norvegicus] |
| GI:254750658 | GenBank | EDL89659.1 | 351 | pleckstrin homology, Sec7 and coiled-coil domains 3, isoform CRA_a [Rattus norvegicus] |
| GI:254750656 | GenBank | EDL89660.1 | 399 | pleckstrin homology, Sec7 and coiled-coil domains 3, isoform CRA_b [Rattus norvegicus] |
| GI:254750658 | GenBank | EGV95757.1 | 351 | Cytohesin-3 [Cricetulus griseus] |
| GI:254750656 | RefSeq | XP_005079999.1 | 399 | PREDICTED: cytohesin-3 isoform X1 [Mesocricetus auratus] |
| GI:254750658 | RefSeq | XP_005080000.1 | 351 | PREDICTED: cytohesin-3 isoform X2 [Mesocricetus auratus] |
| GI:254750656 | RefSeq | XP_005368083.1 | 399 | PREDICTED: cytohesin-3 isoform X1 [Microtus ochrogaster] |
| GI:254750658 | RefSeq | XP_006504728.1 | 351 | PREDICTED: cytohesin-3 isoform X2 [Mus musculus] |
| GI:254750658 | RefSeq | XP_006504729.1 | 351 | PREDICTED: cytohesin-3 isoform X3 [Mus musculus] |
| GI:254750656 | RefSeq | XP_006982713.1 | 399 | PREDICTED: cytohesin-3 [Peromyscus maniculatus bairdii] |
| GI:254750656 | RefSeq | XP_007646901.1 | 399 | PREDICTED: cytohesin-3 isoform X1 [Cricetulus griseus] |
| GI:254750658 | RefSeq | XP_007615072.1 | 351 | PREDICTED: cytohesin-3 isoform X2 [Cricetulus griseus] |
Related Sequences to LMP000120 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:254750656 | DBBJ | BAC29342.1 | 399 | unnamed protein product [Mus musculus] |
| GI:254750658 | DBBJ | BAE34915.1 | 399 | unnamed protein product [Mus musculus] |
| GI:254750656 | DBBJ | BAE40437.1 | 399 | unnamed protein product [Mus musculus] |
| GI:254750656 | GenBank | AAB41445.1 | 400 | sec7C [Rattus norvegicus] |
| GI:254750658 | GenBank | AAH07189.1 | 377 | Cyth3 protein, partial [Mus musculus] |
| GI:254750658 | GenBank | AAE60621.1 | 399 | Sequence 2 from patent US 6194173 |
| GI:254750658 | RefSeq | NP_446364.2 | 399 | cytohesin-3 [Rattus norvegicus] |
| GI:254750658 | RefSeq | NP_035312.3 | 399 | cytohesin-3 isoform 1 [Mus musculus] |
| GI:254750656 | RefSeq | XP_005368084.1 | 400 | PREDICTED: cytohesin-3 isoform X2 [Microtus ochrogaster] |
| GI:254750658 | RefSeq | XP_006982713.1 | 399 | PREDICTED: cytohesin-3 [Peromyscus maniculatus bairdii] |
| GI:254750656 | RefSeq | XP_008822228.1 | 399 | PREDICTED: cytohesin-3 isoform X1 [Nannospalax galili] |
| GI:254750656 | SwissProt | P97696.1 | 400 | RecName: Full=Cytohesin-3; AltName: Full=PH, SEC7 and coiled-coil domain-containing protein 3; AltName: Full=SEC7 homolog C; Short=rSec7-3 [Rattus norvegicus] |