Gene/Proteome Database (LMPD)

LMPD ID
LMP000121
Gene ID
Species
Mus musculus (Mouse)
Gene Name
elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 2
Gene Symbol
Synonyms
AI317360; Ssc2
Chromosome
13
Map Location
13 A3.3|13

Proteins

elongation of very long chain fatty acids protein 2
Refseq ID NP_062296
Protein GI 9507147
UniProt ID Q543J1
mRNA ID NM_019423
Length 292
RefSeq Status VALIDATED
MEQLKAFDNEVNAFLDNMFGPRDSRVRGWFLLDSYLPTFILTITYLLSIWLGNKYMKNRPALSLRGILTLYNLAITLLSAYMLVELILSSWEGGYNLQCQNLDSAGEGDVRVAKVLWWYYFSKLVEFLDTIFFVLRKKTNQITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVFPSMHKYLWWKKYLTQAQLVQFVLTITHTLSAVVKPCGFPFGCLIFQSSYMMTLVILFLNFYIQTYRKKPVKKELQEKEVKNGFPKAHLIVANGMTDKKAQ

Gene Information

Entrez Gene ID
Gene Name
elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 2
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:Ensembl C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0009922 IEA:Ensembl F fatty acid elongase activity
GO:0016747 IDA:MGI F transferase activity, transferring acyl groups other than amino-acyl groups
GO:0034626 IEA:Ensembl P fatty acid elongation, polyunsaturated fatty acid
GO:0042761 IEA:Ensembl P very long-chain fatty acid biosynthetic process
GO:0000038 IDA:MGI P very long-chain fatty acid metabolic process

Domain Information

InterPro Annotations

Accession Description
IPR002076 ELO family

UniProt Annotations

Entry Information

Gene Name
elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 2
Protein Entry
ELOV2_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Catalytic Activity A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2).
Similarity Belongs to the ELO family.

Identical and Related Proteins

Unique RefSeq proteins for LMP000121 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
9507147 RefSeq NP_062296 292 elongation of very long chain fatty acids protein 2

Identical Sequences to LMP000121 proteins

Reference Database Accession Length Protein Name
GI:9507147 GenBank ABS94942.1 292 Sequence 23 from patent US 7205134
GI:9507147 GenBank ABS99958.1 292 Sequence 23 from patent US 7208297
GI:9507147 GenBank ABT11293.1 292 Sequence 23 from patent US 7220897
GI:9507147 GenBank ACE40471.1 292 Sequence 65 from patent US 7375205
GI:9507147 GenBank ADR85391.1 292 Sequence 66 from patent US 7736884
GI:9507147 GenBank AEJ72124.1 292 Sequence 65 from patent US 7968692

Related Sequences to LMP000121 proteins

Reference Database Accession Length Protein Name
GI:9507147 GenBank AAS29262.1 283 Sequence 85 from patent US 6677145
GI:9507147 GenBank ABH83337.1 292 Sequence 74 from patent US 7045683
GI:9507147 GenBank EDL40970.1 304 elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 2, isoform CRA_a, partial [Mus musculus]
GI:9507147 GenBank ACE40484.1 283 Sequence 85 from patent US 7375205
GI:9507147 GenBank AEJ72137.1 283 Sequence 85 from patent US 7968692
GI:9507147 RefSeq XP_005355137.1 296 PREDICTED: elongation of very long chain fatty acids protein 2 [Microtus ochrogaster]