Gene/Proteome Database (LMPD)
Proteins
elongation of very long chain fatty acids protein 2 | |
---|---|
Refseq ID | NP_062296 |
Protein GI | 9507147 |
UniProt ID | Q543J1 |
mRNA ID | NM_019423 |
Length | 292 |
RefSeq Status | VALIDATED |
MEQLKAFDNEVNAFLDNMFGPRDSRVRGWFLLDSYLPTFILTITYLLSIWLGNKYMKNRPALSLRGILTLYNLAITLLSAYMLVELILSSWEGGYNLQCQNLDSAGEGDVRVAKVLWWYYFSKLVEFLDTIFFVLRKKTNQITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVFPSMHKYLWWKKYLTQAQLVQFVLTITHTLSAVVKPCGFPFGCLIFQSSYMMTLVILFLNFYIQTYRKKPVKKELQEKEVKNGFPKAHLIVANGMTDKKAQ |
Gene Information
Entrez Gene ID
Gene Name
elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 2
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:Ensembl | C | endoplasmic reticulum |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0009922 | IEA:Ensembl | F | fatty acid elongase activity |
GO:0016747 | IDA:MGI | F | transferase activity, transferring acyl groups other than amino-acyl groups |
GO:0034626 | IEA:Ensembl | P | fatty acid elongation, polyunsaturated fatty acid |
GO:0042761 | IEA:Ensembl | P | very long-chain fatty acid biosynthetic process |
GO:0000038 | IDA:MGI | P | very long-chain fatty acid metabolic process |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR002076 | ELO family |
UniProt Annotations
Entry Information
Gene Name
elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 2
Protein Entry
ELOV2_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Catalytic Activity | A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2). |
Similarity | Belongs to the ELO family. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000121 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
9507147 | RefSeq | NP_062296 | 292 | elongation of very long chain fatty acids protein 2 |
Identical Sequences to LMP000121 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:9507147 | GenBank | ABS94942.1 | 292 | Sequence 23 from patent US 7205134 |
GI:9507147 | GenBank | ABS99958.1 | 292 | Sequence 23 from patent US 7208297 |
GI:9507147 | GenBank | ABT11293.1 | 292 | Sequence 23 from patent US 7220897 |
GI:9507147 | GenBank | ACE40471.1 | 292 | Sequence 65 from patent US 7375205 |
GI:9507147 | GenBank | ADR85391.1 | 292 | Sequence 66 from patent US 7736884 |
GI:9507147 | GenBank | AEJ72124.1 | 292 | Sequence 65 from patent US 7968692 |
Related Sequences to LMP000121 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:9507147 | GenBank | AAS29262.1 | 283 | Sequence 85 from patent US 6677145 |
GI:9507147 | GenBank | ABH83337.1 | 292 | Sequence 74 from patent US 7045683 |
GI:9507147 | GenBank | EDL40970.1 | 304 | elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 2, isoform CRA_a, partial [Mus musculus] |
GI:9507147 | GenBank | ACE40484.1 | 283 | Sequence 85 from patent US 7375205 |
GI:9507147 | GenBank | AEJ72137.1 | 283 | Sequence 85 from patent US 7968692 |
GI:9507147 | RefSeq | XP_005355137.1 | 296 | PREDICTED: elongation of very long chain fatty acids protein 2 [Microtus ochrogaster] |