Gene/Proteome Database (LMPD)
LMPD ID
LMP000142
Gene ID
Species
Mus musculus (Mouse)
Gene Name
bisphosphate 3'-nucleotidase 1
Gene Symbol
Synonyms
BPntase
Alternate Names
3'(2'),5'-bisphosphate nucleotidase 1;,PIP; PAP-inositol 1,4-phosphatase; PAP-inositol-1,4-phosphatase
Chromosome
1
Map Location
1|1 H4
EC Number
3.1.3.7
Proteins
3'(2'),5'-bisphosphate nucleotidase 1 | |
---|---|
Refseq ID | NP_035924 |
Protein GI | 39652626 |
UniProt ID | Q9Z0S1 |
mRNA ID | NM_011794 |
Length | 308 |
RefSeq Status | VALIDATED |
MASSHTVLMRLVASAYSIAQKAGTIVRCVIAEGDLGIVQKTSATDLQTKADRLVQMSICSSLARKFPKLTIIGEEDLPPGEVDQELIEDGQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGIINQPYYNYQAGPDAALGRTIWGVLGLGAFGFQLKEAPAGKHIITTTRSHSNQLVTDCISAMNPDTVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNALQYNKEVKHMNSAGVLAALRNYEYYASHVPESVKNALIP |
Gene Information
Entrez Gene ID
Gene Name
bisphosphate 3'-nucleotidase 1
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
GO:0008441 | IDA:MGI | F | 3'(2'),5'-bisphosphate nucleotidase activity |
GO:0004441 | IEA:Ensembl | F | inositol-1,4-bisphosphate 1-phosphatase activity |
GO:0000287 | IEA:Ensembl | F | magnesium ion binding |
GO:0016311 | IDA:GOC | P | dephosphorylation |
GO:0046854 | IEA:InterPro | P | phosphatidylinositol phosphorylation |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
mmu01100 | Metabolic pathways |
ko00920 | Sulfur metabolism |
mmu00920 | Sulfur metabolism |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
5893224 | Cytosolic sulfonation of small molecules |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Adenosine 3',5'-bisphosphate + H(2)O = adenosine 5'-phosphate + phosphate. |
Cofactor | Name=Mg(2+); Xref=ChEBI:CHEBI:18420; |
Enzyme Regulation | Uncompetitive inhibition by micromolar concentrations of lithium. Competitive inhibition by inositol 1,4- bisphosphate. |
Function | Converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'- phosphate (PAP) to AMP. Has 1000-fold lower activity towards inositol 1,4-bisphosphate (Ins(1,4)P2) and inositol 1,3,4- trisphosphate (Ins(1,3,4)P3), but does not hydrolyze Ins(1)P, Ins(3,4)P2, Ins(1,3,4,5)P4 or InsP6. |
Similarity | Belongs to the inositol monophosphatase family. {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000142 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
39652626 | RefSeq | NP_035924 | 308 | 3'(2'),5'-bisphosphate nucleotidase 1 |
Identical Sequences to LMP000142 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:39652626 | DBBJ | BAB25850.1 | 308 | unnamed protein product [Mus musculus] |
GI:39652626 | DBBJ | BAE30807.1 | 308 | unnamed protein product [Mus musculus] |
GI:39652626 | DBBJ | BAE30872.1 | 308 | unnamed protein product [Mus musculus] |
GI:39652626 | SwissProt | Q9Z0S1.2 | 308 | RecName: Full=3'(2'),5'-bisphosphate nucleotidase 1; AltName: Full=Bisphosphate 3'-nucleotidase 1; AltName: Full=PAP-inositol 1,4-phosphatase; Short=PIP [Mus musculus] |
Related Sequences to LMP000142 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:39652626 | DBBJ | BAE29926.1 | 308 | unnamed protein product [Mus musculus] |
GI:39652626 | DBBJ | BAE32585.1 | 308 | unnamed protein product [Mus musculus] |
GI:39652626 | GenBank | AAD17330.1 | 308 | bisphosphate 3'-nucleotidase [Mus musculus] |
GI:39652626 | GenBank | AAH11036.1 | 308 | Bisphosphate 3'-nucleotidase 1 [Mus musculus] |
GI:39652626 | GenBank | EDL13068.1 | 308 | bisphosphate 3'-nucleotidase 1, isoform CRA_a [Mus musculus] |
GI:39652626 | GenBank | EDL13070.1 | 308 | bisphosphate 3'-nucleotidase 1, isoform CRA_a [Mus musculus] |