Gene/Proteome Database (LMPD)

LMPD ID
LMP000204
Gene ID
55361
Species
Homo sapiens (Human)
Gene Name
phosphatidylinositol 4-kinase type 2 alpha
Gene Symbol
PI4K2A
Synonyms
PI4KII; PIK42A
Alternate Names
phosphatidylinositol 4-kinase type 2-alpha; phosphatidylinositol 4-kinase type II-alpha; phosphatidylinositol 4-kinase type II (PI4KII)
Chromosome
10
Map Location
10q24
EC Number
2.7.1.67
Summary
Phosphatidylinositolpolyphosphates (PtdInsPs) are centrally involved in many biologic processes, ranging from cell growth and organization of the actin cytoskeleton to endo- and exocytosis. PI4KII phosphorylates PtdIns at the D-4 position, an essential step in the biosynthesis of PtdInsPs (Barylko et al., 2001 [PubMed 11244087]).[supplied by OMIM, Mar 2008]
Orthologs
View orthologs and multiple alignments for PI4K2A

Proteins

phosphatidylinositol 4-kinase type 2-alpha
Refseq ID NP_060895
Protein GI 13559514
UniProt ID Q9BTU6
mRNA ID NM_018425
Length 479
RefSeq Status PROVISIONAL
MDETSPLVSPERAQPPDYTFPSGSGAHFPQVPGGAVRVAAAAGSGPSPPGSPGHDRERQPLLDRARGAAAQGQTQTVAAQAQALAAQAAAAAHAAQAHRERNEFPEDPEFEAVVRQAELAIERCIFPERIYQGSSGSYFVKDPQGRIIAVFKPKNEEPYGHLNPKWTKWLQKLCCPCCFGRDCLVLNQGYLSEAGASLVDQKLELNIVPRTKVVYLASETFNYSAIDRVKSRGKRLALEKVPKVGQRFNRIGLPPKVGSFQLFVEGYKDADYWLRRFEAEPLPENTNRQLLLQFERLVVLDYIIRNTDRGNDNWLIKYDCPMDSSSSRDTDWVVVKEPVIKVAAIDNGLAFPLKHPDSWRAYPFYWAWLPQAKVPFSQEIKDLILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQIAVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFSWW

Gene Information

Entrez Gene ID
55361
Gene Name
phosphatidylinositol 4-kinase type 2 alpha
Gene Symbol
PI4K2A
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IEA:UniProtKB-KW C Golgi apparatus
GO:0030054 IEA:UniProtKB-KW C cell junction
GO:0031410 ISS:UniProtKB C cytoplasmic vesicle
GO:0005829 TAS:Reactome C cytosol
GO:0030425 ISS:UniProtKB C dendrite
GO:0031901 IEA:Ensembl C early endosome membrane
GO:0005768 ISS:UniProtKB C endosome
GO:0070382 IEA:Ensembl C exocytic vesicle
GO:0035838 ISS:UniProtKB C growing cell tip
GO:0044231 ISS:UniProtKB C host cell presynaptic membrane
GO:0005887 IDA:UniProtKB C integral component of plasma membrane
GO:0005765 IDA:UniProtKB C lysosomal membrane
GO:0016020 IDA:UniProtKB C membrane
GO:0045121 IDA:UniProtKB C membrane raft
GO:0005739 ISS:UniProtKB C mitochondrion
GO:0043005 ISS:UniProtKB C neuron projection
GO:0043025 ISS:UniProtKB C neuronal cell body
GO:0043204 IEA:Ensembl C perikaryon
GO:0042734 ISS:UniProtKB C presynaptic membrane
GO:0043234 IEA:Ensembl C protein complex
GO:0030672 IEA:Ensembl C synaptic vesicle membrane
GO:0004430 IDA:UniProtKB F 1-phosphatidylinositol 4-kinase activity
GO:0035651 IDA:UniProtKB F AP-3 adaptor complex binding
GO:0005524 IEA:UniProtKB-KW F ATP binding
GO:0000287 NAS:UniProtKB F magnesium ion binding
GO:0002561 IEA:Ensembl P basophil degranulation
GO:0006661 IDA:UniProtKB P phosphatidylinositol biosynthetic process
GO:0046854 IDA:GOC P phosphatidylinositol phosphorylation
GO:0006644 TAS:Reactome P phospholipid metabolic process
GO:0044281 TAS:Reactome P small molecule metabolic process

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_120836 Synthesis of PIPs at the Golgi membrane
REACT_120756 Synthesis of PIPs at the early endosome membrane
REACT_121025 Synthesis of PIPs at the plasma membrane

Domain Information

InterPro Annotations

Accession Description
IPR000403 Phosphatidylinositol 3-/4-kinase, catalytic domain

UniProt Annotations

Entry Information

Gene Name
phosphatidylinositol 4-kinase type 2 alpha
Protein Entry
P4K2A_HUMAN
UniProt ID
Q9BTU6
Species
Human

Comments

Comment Type Description
Catalytic Activity ATP + 1-phosphatidyl-1D-myo-inositol = ADP + 1-phosphatidyl-1D-myo-inositol 4-phosphate.
Function Together with PI4K2B and the type III PI4Ks (PIK4CA and PIK4CB) it contributes to the overall PI4-kinase activity of the cell. The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3). Contributes to the production of InsP3 in stimulated cells (By similarity). This lipid kinase is the major phosphatidylinositol 4-phosphate (PI4P) producer in the Golgi apparatus, it generates more than 50% of this molecule which is essential for the identity of the organelle, protein sorting and membrane trafficking.
Interaction Q96J02:ITCH; NbExp=5; IntAct=EBI-3239392, EBI-1564678;
Ptm Palmitoylated by ZDHHC3 and ZDHHC7 in the CCPCC motif. Palmitoylation is cholesterol-dependent, and required for TGN localization.
Similarity Belongs to the PI3/PI4-kinase family. Type II PI4K subfamily.
Similarity Contains 1 PI3K/PI4K domain.
Subcellular Location Cytoplasm. Golgi apparatus, trans-Golgi network membrane; Lipid-anchor. Membrane raft. Cell projection, dendrite . Cell junction, synapse, presynaptic cell membrane . Cell junction, synapse, synaptosome {ECO
Subunit Associates with the BLOC-1 and the AP-3 complexes; the BLOC-1 complex is required for optimal binding of PI4K2A to the AP-3 complex. Interacts with BLOC1S5 and DTNBP1. Interacts with FOS; this interaction may enhance phosphatidylinositol phosphorylation activity (By similarity).
Tissue Specificity Widely expressed. Highest expression is observed in kidney, brain, heart, skeletal muscle, and placenta and lowest expression is observed in colon, thymus, and small intestine.

Identical and Related Proteins

Unique RefSeq proteins for LMP000204 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
13559514 RefSeq NP_060895 479 phosphatidylinositol 4-kinase type 2-alpha

Identical Sequences to LMP000204 proteins

Reference Database Accession Length Protein Name
GI:13559514 GenBank JAA03802.1 479 phosphatidylinositol 4-kinase type 2 alpha [Pan troglodytes]
GI:13559514 GenBank JAA13311.1 479 phosphatidylinositol 4-kinase type 2 alpha [Pan troglodytes]
GI:13559514 GenBank JAA24907.1 479 phosphatidylinositol 4-kinase type 2 alpha [Pan troglodytes]
GI:13559514 GenBank JAA40137.1 479 phosphatidylinositol 4-kinase type 2 alpha [Pan troglodytes]
GI:13559514 RefSeq XP_004049954.1 479 PREDICTED: phosphatidylinositol 4-kinase type 2-alpha [Gorilla gorilla gorilla]
GI:13559514 RefSeq XP_004093188.1 479 PREDICTED: LOW QUALITY PROTEIN: phosphatidylinositol 4-kinase type 2-alpha [Nomascus leucogenys]

Related Sequences to LMP000204 proteins

Reference Database Accession Length Protein Name
GI:13559514 GenBank AAQ02479.1 480 phosphatidylinositol 4-kinase type II, partial [synthetic construct]
GI:13559514 GenBank JAB17486.1 479 phosphatidylinositol 4-kinase type 2-alpha [Callithrix jacchus]
GI:13559514 GenBank JAB33024.1 479 phosphatidylinositol 4-kinase type 2-alpha [Callithrix jacchus]
GI:13559514 RefSeq XP_003904130.1 480 PREDICTED: phosphatidylinositol 4-kinase type 2-alpha isoform X1 [Papio anubis]
GI:13559514 RefSeq XP_004749598.1 479 PREDICTED: phosphatidylinositol 4-kinase type 2-alpha [Mustela putorius furo]
GI:13559514 RefSeq XP_005566180.1 480 PREDICTED: phosphatidylinositol 4-kinase type 2-alpha isoform X1 [Macaca fascicularis]