Gene/Proteome Database (LMPD)

LMPD ID
LMP000228
Gene ID
14345
Species
Mus musculus (Mouse)
Gene Name
fucosyltransferase 4
Gene Symbol
Fut4
Synonyms
AI451562; CD15; FAL; FucT-IV; LeX; SSEA-1; Ssea1
Alternate Names
alpha-(1,3)-fucosyltransferase 4; Lewis x; fuc-TIV; fucosyltransferase IV; alpha 1,3-fucosyltransferase; galactoside 3-L-fucosyltransferase; stage-specific embryonic antigen 1; 3-fucosyl-N-acetyl-lactosamine epitope; alpha (1,3) fucosyltransferase, myeloid specific
Chromosome
9
Map Location
9 A2|9 4.3 cM
EC Number
2.4.1.-

Proteins

alpha-(1,3)-fucosyltransferase 4
Refseq ID NP_034372
Protein GI 6753920
UniProt ID Q11127
mRNA ID NM_010242
Length 433
RefSeq Status PROVISIONAL
MAPARQELQHESRCRPSRTVDAWRAAVATRGRHMETPGYRRRTRCGGWGLPRSVSSLAAVGLLCTALTTFICWGQLPPLPWASPAPQRLVGVLLWWEPFRGRGGYPKSPPDCSLRFNISGCRLLTDRAAYGEAQAVLFHHRDLVKELHDWPPPWGARERTDKALVLRVFDDQEGAVTLTGKALETVGSRPPGQRWVWMNFESPSHTPGLRGLAKDLFNWTLSYRTDSDVFVPYGFLYSRSDPTEQPSGLGPQLARKRGLVAWVVSNWNEHQARVRYYHQLSRHVSVDVFGRTGPGRPVPAIGLLHTVARYKFYLAFENSRHVDYITEKLWRNAFLAGAVPVVLGPDRANYERFVPRGAFIHVDDFPNAASLAAYLLFLDRNVAVYRRYFRWRRSFAVHITSFWDEQWCRTCQAVQTSGDQPKSIHNLADWFQR

Gene Information

Entrez Gene ID
14345
Gene Name
fucosyltransferase 4
Gene Symbol
Fut4
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IEA:UniProtKB-KW C Golgi apparatus
GO:0071944 IDA:MGI C cell periphery
GO:0009986 IDA:MGI C cell surface
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0008417 IEA:InterPro F fucosyltransferase activity
GO:0006486 IEA:UniProtKB-UniPathway P protein glycosylation

KEGG Pathway Links

KEGG Pathway ID Description
mmu00601 Glycosphingolipid biosynthesis - lacto and neolacto series
mmu01100 Metabolic pathways
ko00514 Other types of O-glycan biosynthesis
mmu00514 Other types of O-glycan biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR001503 Glycosyl transferase, family 10

UniProt Annotations

Entry Information

Gene Name
fucosyltransferase 4
Protein Entry
FUT4_MOUSE
UniProt ID
Q11127
Species
Mouse

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=Long; IsoId=Q11127-1; Sequence=Displayed; Name=Short; IsoId=Q11127-2; Sequence=VSP_001778;
Function May catalyze alpha-1,3 glycosidic linkages involved in the expression of Lewis X/SSEA-1 and VIM-2 antigens.
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the glycosyltransferase 10 family. {ECO:0000305}.
Subcellular Location Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Note=Membrane-bound form in trans cisternae of Golgi.
Tissue Specificity Highest expression in stomach and colon. It is also expressed in the lung, testis, uterus, small intestine and to a lesser extent in spleen, and ovary. Present in trace amounts in brain, thymus, heart, smooth muscle, kidney and bone marrow. Not found in liver, salivary gland and pancreas.
Web Resource Name=Functional Glycomics Gateway - GTase; Note=Fucosyltransferase 4; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_mou_613";

Identical and Related Proteins

Unique RefSeq proteins for LMP000228 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6753920 RefSeq NP_034372 433 alpha-(1,3)-fucosyltransferase 4

Identical Sequences to LMP000228 proteins

Reference Database Accession Length Protein Name
GI:6753920 DBBJ BAC31054.1 433 unnamed protein product [Mus musculus]
GI:6753920 GenBank ABC07482.1 433 Sequence 11 from patent US 6962806
GI:6753920 GenBank ABH66242.1 433 Sequence 11 from patent US 7029891
GI:6753920 GenBank ABN31404.1 433 Sequence 11 from patent US 7166449
GI:6753920 GenBank EDL25001.1 433 fucosyltransferase 4 [Mus musculus]
GI:6753920 GenBank AFG79856.1 433 Sequence 115 from patent US 8137928

Related Sequences to LMP000228 proteins

Reference Database Accession Length Protein Name
GI:6753920 DBBJ BAA09697.1 400 alpha-1,3-fucosyltransferase [Mus musculus]
GI:6753920 DBBJ BAB68648.1 390 alpha 1,3-fucosyltransferase, partial [Mus musculus domesticus]
GI:6753920 DBBJ BAB68655.1 390 alpha 1,3-fucosyltransferase, partial [Mus musculus castaneus]
GI:6753920 GenBank AAI37589.1 433 Fut4 protein [Mus musculus]
GI:6753920 PIR - 400 alpha-1,3 fucosyltransferase (EC 2.4.1.-) - mouse [Mus musculus]
GI:6753920 PRF - 400 fucosyltransferase [Mus musculus]