Gene/Proteome Database (LMPD)
LMPD ID
LMP000231
Gene ID
Species
Homo sapiens (Human)
Gene Name
patatin-like phospholipase domain containing 3
Gene Symbol
Synonyms
ADPN; C22orf20; iPLA(2)epsilon
Alternate Names
patatin-like phospholipase domain-containing protein 3; adiponutrin; iPLA2epsilon; iPLA2-epsilon; acylglycerol O-acyltransferase; calcium-independent phospholipase A2-epsilon
Chromosome
22
Map Location
22q13.31
EC Number
3.1.1.3
Summary
The protein encoded by this gene is a triacylglycerol lipase that mediates triacylglycerol hydrolysis in adipocytes. The encoded protein, which appears to be membrane bound, may be involved in the balance of energy usage/storage in adipocytes. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| patatin-like phospholipase domain-containing protein 3 | |
|---|---|
| Refseq ID | NP_079501 |
| Protein GI | 17196626 |
| UniProt ID | Q9NST1 |
| mRNA ID | NM_025225 |
| Length | 481 |
| RefSeq Status | REVIEWED |
| MYDAERGWSLSFAGCGFLGFYHVGATRCLSEHAPHLLRDARMLFGASAGALHCVGVLSGIPLEQTLQVLSDLVRKARSRNIGIFHPSFNLSKFLRQGLCKCLPANVHQLISGKIGISLTRVSDGENVLVSDFRSKDEVVDALVCSCFIPFYSGLIPPSFRGVRYVDGGVSDNVPFIDAKTTITVSPFYGEYDICPKVKSTNFLHVDITKLSLRLCTGNLYLLSRAFVPPDLKVLGEICLRGYLDAFRFLEEKGICNRPQPGLKSSSEGMDPEVAMPSWANMSLDSSPESAALAVRLEGDELLDHLRLSILPWDESILDTLSPRLATALSEEMKDKGGYMSKICNLLPIRIMSYVMLPCTLPVESAIAIVQRLVTWLPDMPDDVLWLQWVTSQVFTRVLMCLLPASRSQMPVSSQQASPCTPEQDWPCWTPCSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKSL | |
Gene Information
Entrez Gene ID
Gene Name
patatin-like phospholipase domain containing 3
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005789 | TAS:Reactome | C | endoplasmic reticulum membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016020 | ISS:UniProtKB | C | membrane |
| GO:0051265 | IDA:UniProtKB | F | diolein transacylation activity |
| GO:0051264 | IDA:UniProtKB | F | mono-olein transacylation activity |
| GO:0004623 | IDA:UniProtKB | F | phospholipase A2 activity |
| GO:0004806 | IDA:UniProtKB | F | triglyceride lipase activity |
| GO:0036155 | TAS:Reactome | P | acylglycerol acyl-chain remodeling |
| GO:0046474 | TAS:Reactome | P | glycerophospholipid biosynthetic process |
| GO:0006644 | TAS:Reactome | P | phospholipid metabolic process |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0019432 | IDA:UniProtKB | P | triglyceride biosynthetic process |
| GO:0019433 | IDA:UniProtKB | P | triglyceride catabolic process |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_121122 | Acyl chain remodeling of DAG and TAG |
Domain Information
UniProt Annotations
Entry Information
Gene Name
patatin-like phospholipase domain containing 3
Protein Entry
PLPL3_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9NST1-1; Sequence=Displayed; Name=2; IsoId=Q9NST1-2; Sequence=VSP_036222; Note=No experimental confirmation available.; |
| Catalytic Activity | Triacylglycerol + H(2)O = diacylglycerol + a carboxylate. |
| Disease | Non-alcoholic fatty liver disease 1 (NAFLD1) [MIM |
| Function | Multifunctional enzyme which has both triacylglycerol lipase and acylglycerol O-acyltransferase activities. |
| Induction | By changes in energy balance: down-regulated following very low-calorie diet, whereas refeeding elevates the mRNA level. |
| Pathway | Glycerolipid metabolism; triacylglycerol degradation. |
| Polymorphism | Polymorphic variation at position 148 influences insulin secretion levels and obesity. In obese subjects the body mass index and waist are higher in carriers of the Ile-148 allele. The Ile-148 carriers also display decreased insulin secretion in response to oral glucose tolerance test. Met-148 allele carriers are seemingly more insulin resistant at a lower body mass index. |
| Similarity | Contains 1 patatin domain. |
| Subcellular Location | Membrane ; Single-pass type II membrane protein . |
Identical and Related Proteins
Unique RefSeq proteins for LMP000231 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 17196626 | RefSeq | NP_079501 | 481 | patatin-like phospholipase domain-containing protein 3 |
Identical Sequences to LMP000231 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:17196626 | GenBank | ADM02204.1 | 481 | Sequence 2 from patent US 7723497 |
| GI:17196626 | GenBank | AED82135.1 | 481 | Sequence 872 from patent US 7919467 |
| GI:17196626 | GenBank | AEU43495.1 | 481 | Sequence 244 from patent US 8052970 |
| GI:17196626 | GenBank | AEU43500.1 | 481 | Sequence 249 from patent US 8052970 |
| GI:17196626 | GenBank | AHD77479.1 | 481 | Sequence 23608 from patent US 8586006 |
| GI:17196626 | GenBank | AHE11010.1 | 481 | Sequence 2 from patent US 8597893 |
Related Sequences to LMP000231 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:17196626 | DBBJ | BAG37610.1 | 481 | unnamed protein product [Homo sapiens] |
| GI:17196626 | EMBL | CAK54457.1 | 481 | ADPN [synthetic construct] |
| GI:17196626 | EMBL | CAK54756.1 | 481 | ADPN, partial [synthetic construct] |
| GI:17196626 | GenBank | EAW73324.1 | 481 | adiponutrin, isoform CRA_b [Homo sapiens] |
| GI:17196626 | GenBank | ADS87442.1 | 481 | Sequence 318 from patent US 7820380 |
| GI:17196626 | GenBank | AEW40437.1 | 481 | Sequence 318 from patent US 8071302 |