Gene/Proteome Database (LMPD)

LMPD ID
LMP000247
Gene ID
5465
Species
Homo sapiens (Human)
Gene Name
peroxisome proliferator-activated receptor alpha
Gene Symbol
PPARA
Synonyms
NR1C1; PPAR; PPARalpha; hPPAR
Chromosome
22
Map Location
22q13.31
Summary
Peroxisome proliferators include hypolipidemic drugs, herbicides, leukotriene antagonists, and plasticizers; this term arises because they induce an increase in the size and number of peroxisomes. Peroxisomes are subcellular organelles found in plants and animals that contain enzymes for respiration and for cholesterol and lipid metabolism. The action of peroxisome proliferators is thought to be mediated via specific receptors, called PPARs, which belong to the steroid hormone receptor superfamily. PPARs affect the expression of target genes involved in cell proliferation, cell differentiation and in immune and inflammation responses. Three closely related subtypes (alpha, beta/delta, and gamma) have been identified. This gene encodes the subtype PPAR-alpha, which is a nuclear transcription factor. Multiple alternatively spliced transcript variants have been described for this gene, although the full-length nature of only two has been determined. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for PPARA

Proteins

peroxisome proliferator-activated receptor alpha
Refseq ID NP_001001928
Protein GI 50348666
UniProt ID Q07869
mRNA ID NM_001001928
Length 468
RefSeq Status REVIEWED
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
peroxisome proliferator-activated receptor alpha
Refseq ID NP_005027
Protein GI 7549811
UniProt ID Q07869
mRNA ID NM_005036
Length 468
RefSeq Status REVIEWED
Protein sequence is identical to GI:50348666 (mRNA isoform)

Gene Information

Entrez Gene ID
5465
Gene Name
peroxisome proliferator-activated receptor alpha
Gene Symbol
PPARA
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005634 IEA:UniProtKB-KW C nucleus
GO:0001190 IEA:Ensembl F RNA polymerase II transcription factor binding transcription factor activity involved in positive regulation of transcription
GO:0004879 IEA:Ensembl F ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity
GO:0008289 IEA:Ensembl F lipid binding
GO:0043565 IEA:Ensembl F sequence-specific DNA binding
GO:0003707 IEA:InterPro F steroid hormone receptor activity
GO:0008270 IEA:InterPro F zinc ion binding
GO:0035095 IEA:Ensembl P behavioral response to nicotine
GO:0032922 IEA:Ensembl P circadian regulation of gene expression
GO:0070166 IEA:Ensembl P enamel mineralization
GO:0008544 IEA:Ensembl P epidermis development
GO:0006631 IEA:Ensembl P fatty acid metabolic process
GO:0007507 IEA:Ensembl P heart development
GO:0042157 IEA:Ensembl P lipoprotein metabolic process
GO:0032099 IEA:Ensembl P negative regulation of appetite
GO:0045776 IEA:Ensembl P negative regulation of blood pressure
GO:1901215 IEA:Ensembl P negative regulation of neuron death
GO:0032091 IEA:Ensembl P negative regulation of protein binding
GO:2000678 IEA:Ensembl P negative regulation of transcription regulatory region DNA binding
GO:0046321 IEA:Ensembl P positive regulation of fatty acid oxidation
GO:0045722 IEA:Ensembl P positive regulation of gluconeogenesis
GO:0042752 IEA:Ensembl P regulation of circadian rhythm
GO:0001666 IEA:Ensembl P response to hypoxia
GO:0032868 IEA:Ensembl P response to insulin
GO:0042060 IEA:Ensembl P wound healing

KEGG Pathway Links

KEGG Pathway ID Description
hsa04932 Non-alcoholic fatty liver disease (NAFLD)
hsa04024 cAMP signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR008946 Nuclear hormone receptor, ligand-binding
IPR000536 Nuclear hormone receptor, ligand-binding, core
IPR003074 Peroxisome proliferator-activated receptor
IPR003076 Peroxisome proliferator-activated receptor, alpha
IPR001723 Steroid hormone receptor
IPR013088 Zinc finger, NHR/GATA-type
IPR001628 Zinc finger, nuclear hormone receptor-type

UniProt Annotations

Entry Information

Gene Name
peroxisome proliferator-activated receptor alpha
Protein Entry
PPARA_HUMAN
UniProt ID
Q07869
Species
Human

Comments

Comment Type Description
Similarity Belongs to the nuclear hormone receptor family.
Similarity Contains nuclear receptor DNA-binding domain.

Identical and Related Proteins

Unique RefSeq proteins for LMP000247 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
50348666 RefSeq NP_001001928 468 peroxisome proliferator-activated receptor alpha

Identical Sequences to LMP000247 proteins

Reference Database Accession Length Protein Name
GI:50348666 GenBank AHD80302.1 468 Sequence 32118 from patent US 8586006
GI:50348666 GenBank AHD80303.1 468 Sequence 32119 from patent US 8586006
GI:50348666 GenBank AHD80304.1 468 Sequence 32120 from patent US 8586006
GI:50348666 GenBank AHE19862.1 468 Sequence 36 from patent US 8574635
GI:50348666 RefSeq XP_006724332.1 468 PREDICTED: peroxisome proliferator-activated receptor alpha isoform X6 [Homo sapiens]
GI:50348666 RefSeq XP_006724333.1 468 PREDICTED: peroxisome proliferator-activated receptor alpha isoform X7 [Homo sapiens]

Related Sequences to LMP000247 proteins

Reference Database Accession Length Protein Name
GI:50348666 GenBank AAA36468.1 468 peroxisome proliferator activated receptor [Homo sapiens]
GI:50348666 GenBank AAE72572.1 468 Sequence 8 from patent US 6236946
GI:50348666 GenBank AAS36109.1 468 Sequence 3 from patent US 6689574
GI:50348666 GenBank ACM85438.1 469 Sequence 10936 from patent US 6812339
GI:50348666 RefSeq XP_003278613.1 468 PREDICTED: peroxisome proliferator-activated receptor alpha isoform 1 [Nomascus leucogenys]
GI:50348666 RefSeq XP_003278614.1 468 PREDICTED: peroxisome proliferator-activated receptor alpha isoform 2 [Nomascus leucogenys]