Gene/Proteome Database (LMPD)
Proteins
lecithin retinol acyltransferase | |
---|---|
Refseq ID | NP_076113 |
Protein GI | 12963753 |
UniProt ID | Q9JI60 |
mRNA ID | NM_023624 |
Length | 231 |
RefSeq Status | VALIDATED |
MKNPMLEAASLLLEKLLLISNFKLFSVSVPGGGTGKNRPYEISSFVRGDVLEVSRTHFIHYGIYLGENRVAHLMPDILLALTNDKERTQKVVSNKRLLLGVICKVASIRVDTVEDFAYGADILVNHLDGTLKKKSLLNEEVARRAEQQLGLTPYSLLWNNCEHFVTYCRYGSRISPQAEKFYDTVKIIIRDQRSSLASAVLGLASIVYTGLASYMTLPAICIPFCLWMMSG |
Gene Information
Entrez Gene ID
Gene Name
lecithin-retinol acyltransferase (phosphatidylcholine-retinol-O-acyltransferase)
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005771 | IEA:Ensembl | C | multivesicular body |
GO:0048471 | IEA:Ensembl | C | perinuclear region of cytoplasm |
GO:0005791 | IEA:Ensembl | C | rough endoplasmic reticulum |
GO:0008374 | IDA:MGI | F | O-acyltransferase activity |
GO:0047173 | IEA:Ensembl | F | phosphatidylcholine-retinol O-acyltransferase activity |
GO:0001972 | IEA:Ensembl | F | retinoic acid binding |
GO:0019841 | IEA:Ensembl | F | retinol binding |
GO:0006653 | TAS:MGI | P | 1,2-diacyl-sn-glycero-3-phosphocholine metabolic process |
GO:0032370 | IGI:MGI | P | positive regulation of lipid transport |
GO:0042573 | IEA:Ensembl | P | retinoic acid metabolic process |
GO:0042572 | IMP:MGI | P | retinol metabolic process |
GO:0006776 | IDA:MGI | P | vitamin A metabolic process |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR007053 | LRAT-like domain |
UniProt Annotations
Entry Information
Gene Name
lecithin-retinol acyltransferase (phosphatidylcholine-retinol-O-acyltransferase)
Protein Entry
LRAT_MOUSE
UniProt ID
Species
Mouse
Identical and Related Proteins
Unique RefSeq proteins for LMP000248 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
12963753 | RefSeq | NP_076113 | 231 | lecithin retinol acyltransferase |
Identical Sequences to LMP000248 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:12963753 | DBBJ | BAB23696.1 | 231 | unnamed protein product [Mus musculus] |
GI:12963753 | GenBank | AAF97787.1 | 231 | lecithin retinol acyltransferase [Mus musculus] |
GI:12963753 | GenBank | EDL15427.1 | 231 | lecithin-retinol acyltransferase (phosphatidylcholine-retinol-O-acyltransferase) [Mus musculus] |
GI:12963753 | GenBank | AAI41379.1 | 231 | Lecithin-retinol acyltransferase (phosphatidylcholine-retinol-O-acyltransferase) [Mus musculus] |
GI:12963753 | GenBank | AAI41376.1 | 231 | Lecithin-retinol acyltransferase (phosphatidylcholine-retinol-O-acyltransferase) [Mus musculus] |
GI:12963753 | SwissProt | Q9JI60.1 | 231 | RecName: Full=Lecithin retinol acyltransferase; AltName: Full=Phosphatidylcholine--retinol O-acyltransferase; AltName: Full=Phosphatidylcholine-retinol-O-acyltransferase [Mus musculus] |
Related Sequences to LMP000248 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:12963753 | GenBank | AAF97786.1 | 231 | lecithin retinol acyltransferase [Rattus norvegicus] |
GI:12963753 | GenBank | EDM00844.1 | 231 | rCG62473, isoform CRA_a [Rattus norvegicus] |
GI:12963753 | GenBank | EDM00845.1 | 231 | rCG62473, isoform CRA_a [Rattus norvegicus] |
GI:12963753 | RefSeq | NP_071616.1 | 231 | lecithin retinol acyltransferase [Rattus norvegicus] |
GI:12963753 | RefSeq | XP_005076220.1 | 231 | PREDICTED: lecithin retinol acyltransferase [Mesocricetus auratus] |
GI:12963753 | SwissProt | Q9JI61.1 | 231 | RecName: Full=Lecithin retinol acyltransferase; AltName: Full=Phosphatidylcholine--retinol O-acyltransferase [Rattus norvegicus] |