Gene/Proteome Database (LMPD)
LMPD ID
LMP000259
Gene ID
Species
Homo sapiens (Human)
Gene Name
cytochrome P450, family 11, subfamily A, polypeptide 1
Gene Symbol
Synonyms
CYP11A; CYPXIA1; P450SCC
Alternate Names
cholesterol side-chain cleavage enzyme, mitochondrial; steroid 20-22-lyase; cytochrome P450 11A1; cytochrome P450(scc); cytochrome P450C11A1; cholesterol 20-22 desmolase; cholesterol monooxygenase (side-chain cleaving); cytochrome P450, subfamily XIA (cholesterol side chain cleavage)
Chromosome
15
Map Location
15q23-q24
EC Number
1.14.15.6
Summary
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and catalyzes the conversion of cholesterol to pregnenolone, the first and rate-limiting step in the synthesis of the steroid hormones. Two transcript variants encoding different isoforms have been found for this gene. The cellular location of the smaller isoform is unclear since it lacks the mitochondrial-targeting transit peptide. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| cholesterol side-chain cleavage enzyme, mitochondrial isoform a precursor | |
|---|---|
| Refseq ID | NP_000772 |
| Protein GI | 153218646 |
| UniProt ID | P05108 |
| mRNA ID | NM_000781 |
| Length | 521 |
| RefSeq Status | REVIEWED |
| MLAKGLPPRSVLVKGCQTFLSAPREGLGRLRVPTGEGAGISTRSPRPFNEIPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVALLFKSEGPNPERFLIPPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISDDLFRFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQMFHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIYTQNFYWELRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAARHQAQGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTRWLSKDKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLILMPEKPISFTFWPFNQEATQQ | |
| cholesterol side-chain cleavage enzyme, mitochondrial isoform b | |
|---|---|
| Refseq ID | NP_001093243 |
| Protein GI | 153218654 |
| UniProt ID | P05108 |
| mRNA ID | NM_001099773 |
| Length | 363 |
| RefSeq Status | REVIEWED |
| MAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISDDLFRFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQMFHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIYTQNFYWELRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAARHQAQGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTRWLSKDKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLILMPEKPISFTFWPFNQEATQQ | |
| transit_peptide: 1..39 calculated_mol_wt: 4021 peptide sequence: MLAKGLPPRSVLVKGCQTFLSAPREGLGRLRVPTGEGAG mat_peptide: 40..521 product: cholesterol side-chain cleavage enzyme, mitochondrial isoform a calculated_mol_wt: 56100 peptide sequence: ISTRSPRPFNEIPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVALLFKSEGPNPERFLIPPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISDDLFRFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQMFHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIYTQNFYWELRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAARHQAQGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTRWLSKDKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLILMPEKPISFTFWPFNQEATQQ | |
Gene Information
Entrez Gene ID
Gene Name
cytochrome P450, family 11, subfamily A, polypeptide 1
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0030061 | IEA:Ensembl | C | mitochondrial crista |
| GO:0005759 | TAS:Reactome | C | mitochondrial matrix |
| GO:0005739 | ISS:UniProtKB | C | mitochondrion |
| GO:0043204 | IEA:Ensembl | C | perikaryon |
| GO:0015485 | IEA:Ensembl | F | cholesterol binding |
| GO:0008386 | IDA:UniProtKB | F | cholesterol monooxygenase (side-chain-cleaving) activity |
| GO:0020037 | IDA:UniProtKB | F | heme binding |
| GO:0005506 | IEA:InterPro | F | iron ion binding |
| GO:0006700 | IDA:UniProtKB | P | C21-steroid hormone biosynthetic process |
| GO:0033327 | IEA:Ensembl | P | Leydig cell differentiation |
| GO:0014037 | IEA:Ensembl | P | Schwann cell differentiation |
| GO:0018879 | IEA:Ensembl | P | biphenyl metabolic process |
| GO:0071236 | IEA:Ensembl | P | cellular response to antibiotic |
| GO:0071320 | IEA:Ensembl | P | cellular response to cAMP |
| GO:0071276 | IEA:Ensembl | P | cellular response to cadmium ion |
| GO:0044344 | IEA:Ensembl | P | cellular response to fibroblast growth factor stimulus |
| GO:0071372 | IEA:Ensembl | P | cellular response to follicle-stimulating hormone stimulus |
| GO:0071347 | IEA:Ensembl | P | cellular response to interleukin-1 |
| GO:0071222 | IEA:Ensembl | P | cellular response to lipopolysaccharide |
| GO:0071375 | IEA:Ensembl | P | cellular response to peptide hormone stimulus |
| GO:0071560 | IEA:Ensembl | P | cellular response to transforming growth factor beta stimulus |
| GO:0071356 | IEA:Ensembl | P | cellular response to tumor necrosis factor |
| GO:0021549 | IEA:Ensembl | P | cerebellum development |
| GO:0008203 | IDA:UniProtKB | P | cholesterol metabolic process |
| GO:0018894 | IEA:Ensembl | P | dibenzo-p-dioxin metabolic process |
| GO:0006703 | IEA:Ensembl | P | estrogen biosynthetic process |
| GO:0050756 | IEA:Ensembl | P | fractalkine metabolic process |
| GO:0060014 | IEA:Ensembl | P | granulosa cell differentiation |
| GO:0021766 | IEA:Ensembl | P | hippocampus development |
| GO:0060135 | IEA:Ensembl | P | maternal process involved in female pregnancy |
| GO:0007617 | IEA:Ensembl | P | mating behavior |
| GO:0018958 | IEA:Ensembl | P | phenol-containing compound metabolic process |
| GO:0018963 | IEA:Ensembl | P | phthalate metabolic process |
| GO:0006701 | IEA:Ensembl | P | progesterone biosynthetic process |
| GO:0033591 | IEA:Ensembl | P | response to L-ascorbic acid |
| GO:0043279 | IEA:Ensembl | P | response to alkaloid |
| GO:0051412 | IEA:Ensembl | P | response to corticosterone |
| GO:0042493 | IEA:Ensembl | P | response to drug |
| GO:0060992 | IEA:Ensembl | P | response to fungicide |
| GO:0010332 | IEA:Ensembl | P | response to gamma radiation |
| GO:0033595 | IEA:Ensembl | P | response to genistein |
| GO:0042542 | IEA:Ensembl | P | response to hydrogen peroxide |
| GO:0017085 | IEA:Ensembl | P | response to insecticide |
| GO:0009651 | IEA:Ensembl | P | response to salt stress |
| GO:0033197 | IEA:Ensembl | P | response to vitamin E |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0008202 | TAS:Reactome | P | steroid metabolic process |
| GO:0016125 | TAS:Reactome | P | sterol metabolic process |
| GO:0061370 | IEA:Ensembl | P | testosterone biosynthetic process |
| GO:0042359 | ISS:UniProtKB | P | vitamin D metabolic process |
| GO:0006805 | TAS:Reactome | P | xenobiotic metabolic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
cytochrome P450, family 11, subfamily A, polypeptide 1
Protein Entry
CP11A_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P05108-1; Sequence=Displayed; Name=2; IsoId=P05108-2; Sequence=VSP_045695; Note=No experimental confirmation available.; |
| Catalytic Activity | Cholesterol + 6 reduced adrenodoxin + 3 O(2) + 6 H(+) = pregnenolone + 4-methylpentanal + 6 oxidized adrenodoxin + 4 H(2)O. |
| Cofactor | Name=heme; Xref=ChEBI |
| Disease | Adrenal insufficiency, congenital, with 46,XY sex reversal (AICSR) [MIM |
| Function | Catalyzes the side-chain cleavage reaction of cholesterol to pregnenolone. |
| Induction | By 8-bromo cyclic AMP. |
| Pathway | Lipid metabolism; C21-steroid hormone metabolism. |
| Similarity | Belongs to the cytochrome P450 family. |
| Subcellular Location | Mitochondrion membrane. |
| Subunit | Interacts with FDX1/adrenodoxin. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000259 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 153218646 | RefSeq | NP_000772 | 521 | cholesterol side-chain cleavage enzyme, mitochondrial isoform a precursor |
| 153218654 | RefSeq | NP_001093243 | 363 | cholesterol side-chain cleavage enzyme, mitochondrial isoform b |
Identical Sequences to LMP000259 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:153218646 | DBBJ | BAF84989.1 | 521 | unnamed protein product [Homo sapiens] |
| GI:153218646 | DBBJ | BAI46612.1 | 521 | cytochrome P450, family 11, subfamily A, polypeptide 1, partial [synthetic construct] |
| GI:153218654 | GenBank | EAW99341.1 | 363 | cytochrome P450, family 11, subfamily A, polypeptide 1, isoform CRA_a [Homo sapiens] |
| GI:153218646 | GenBank | EAW99342.1 | 521 | cytochrome P450, family 11, subfamily A, polypeptide 1, isoform CRA_b [Homo sapiens] |
| GI:153218646 | GenBank | ABM82504.1 | 521 | cytochrome P450, family 11, subfamily A, polypeptide 1 [synthetic construct] |
| GI:153218646 | GenBank | ABM85697.1 | 521 | cytochrome P450, family 11, subfamily A, polypeptide 1, partial [synthetic construct] |
| GI:153218646 | SwissProt | P05108.2 | 521 | RecName: Full=Cholesterol side-chain cleavage enzyme, mitochondrial; AltName: Full=CYPXIA1; AltName: Full=Cholesterol desmolase; AltName: Full=Cytochrome P450 11A1; AltName: Full=Cytochrome P450(scc); Flags: Precursor [Homo sapiens] |
Related Sequences to LMP000259 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:153218654 | DBBJ | BAF84989.1 | 521 | unnamed protein product [Homo sapiens] |
| GI:153218654 | DBBJ | BAI46612.1 | 521 | cytochrome P450, family 11, subfamily A, polypeptide 1, partial [synthetic construct] |
| GI:153218646 | DBBJ | BAK61896.1 | 521 | cytochrome P450 11A1, mitochondrial precursor [Pan troglodytes] |
| GI:153218646 | EMBL | CAA28965.1 | 521 | desmolase [Homo sapiens] |
| GI:153218646 | GenBank | AAA52162.1 | 521 | cholesterol side-chain cleavage enzyme P450scc (EC 1.14.15.67) [Homo sapiens] |
| GI:153218654 | GenBank | AAH32329.1 | 521 | Cytochrome P450, family 11, subfamily A, polypeptide 1 [Homo sapiens] |
| GI:153218654 | GenBank | AAX42484.1 | 521 | cytochrome P450 family 11 subfamily A polypeptide 1 [synthetic construct] |
| GI:153218646 | GenBank | AIC54258.1 | 521 | CYP11A1, partial [synthetic construct] |
| GI:153218646 | PRF | - | 521 | cytochrome P450 [Homo sapiens] |
| GI:153218654 | RefSeq | NP_000772.2 | 521 | cholesterol side-chain cleavage enzyme, mitochondrial isoform a precursor [Homo sapiens] |
| GI:153218646 | RefSeq | NP_001267337.1 | 521 | cholesterol side-chain cleavage enzyme, mitochondrial [Pan troglodytes] |
| GI:153218654 | SwissProt | P05108.2 | 521 | RecName: Full=Cholesterol side-chain cleavage enzyme, mitochondrial; AltName: Full=CYPXIA1; AltName: Full=Cholesterol desmolase; AltName: Full=Cytochrome P450 11A1; AltName: Full=Cytochrome P450(scc); Flags: Precursor [Homo sapiens] |