Gene/Proteome Database (LMPD)

LMPD ID
LMP000401
Gene ID
8869
Species
Homo sapiens (Human)
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 5
Gene Symbol
ST3GAL5
Synonyms
SATI; SIAT9; SIATGM3S; ST3GalV
Alternate Names
lactosylceramide alpha-2,3-sialyltransferase; ST3Gal V; GM3 synthase; ganglioside GM3 synthase; alpha 2,3-sialyltransferase V; CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase; sialyltransferase 9 (CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase; GM3 synthase)
Chromosome
2
Map Location
2p11.2
EC Number
2.4.99.9
Summary
Ganglioside GM3 is known to participate in the induction of cell differentiation, modulation of cell proliferation, maintenance of fibroblast morphology, signal transduction, and integrin-mediated cell adhesion. The protein encoded by this gene is a type II membrane protein which catalyzes the formation of GM3 using lactosylceramide as the substrate. The encoded protein is a member of glycosyltransferase family 29 and may be localized to the Golgi apparatus. Mutation in this gene has been associated with Amish infantile epilepsy syndrome. Transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for ST3GAL5

Proteins

lactosylceramide alpha-2,3-sialyltransferase isoform 1
Refseq ID NP_003887
Protein GI 109633044
UniProt ID Q9UNP4
mRNA ID NM_003896
Length 418
RefSeq Status REVIEWED
MRTKAAGCAERRPLQPRTEAAAAPAGRAMPSEYTYVKLRSDCSRPSLQWYTRAQSKMRRPSLLLKDILKCTLLVFGVWILYILKLNYTTEECDMKKMHYVDPDHVKRAQKYAQQVLQKECRPKFAKTSMALLFEHRYSVDLLPFVQKAPKDSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGSGGILHGLELGHTLNQFDVVIRLNSAPVEGYSEHVGNKTTIRMTYPEGAPLSDLEYYSNDLFVAVLFKSVDFNWLQAMVKKETLPFWVRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWGRDKNVPTIGVIAVVLATHLCDEVSLAGFGYDLNQPRTPLHYFDSQCMAAMNFQTMHNVTTETKFLLKLVKEGVVKDLSGGIDREF
lactosylceramide alpha-2,3-sialyltransferase isoform 2
Refseq ID NP_001035902
Protein GI 109633046
UniProt ID Q9UNP4
mRNA ID NM_001042437
Length 395
RefSeq Status REVIEWED
MASVPMPSEYTYVKLRSDCSRPSLQWYTRAQSKMRRPSLLLKDILKCTLLVFGVWILYILKLNYTTEECDMKKMHYVDPDHVKRAQKYAQQVLQKECRPKFAKTSMALLFEHRYSVDLLPFVQKAPKDSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGSGGILHGLELGHTLNQFDVVIRLNSAPVEGYSEHVGNKTTIRMTYPEGAPLSDLEYYSNDLFVAVLFKSVDFNWLQAMVKKETLPFWVRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWGRDKNVPTIGVIAVVLATHLCDEVSLAGFGYDLNQPRTPLHYFDSQCMAAMNFQTMHNVTTETKFLLKLVKEGVVKDLSGGIDREF

Gene Information

Entrez Gene ID
8869
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 5
Gene Symbol
ST3GAL5
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0000139 NAS:UniProtKB C Golgi membrane
GO:0030173 IEA:InterPro C integral component of Golgi membrane
GO:0016021 TAS:ProtInc C integral component of membrane
GO:0005887 TAS:ProtInc C integral component of plasma membrane
GO:0047291 IDA:UniProtKB F lactosylceramide alpha-2,3-sialyltransferase activity
GO:0004513 TAS:ProtInc F neolactotetraosylceramide alpha-2,3-sialyltransferase activity
GO:0008373 TAS:ProtInc F sialyltransferase activity
GO:0005975 TAS:ProtInc P carbohydrate metabolic process
GO:0001574 NAS:UniProtKB P ganglioside biosynthetic process
GO:0006688 TAS:ProtInc P glycosphingolipid biosynthetic process
GO:0006486 IEA:InterPro P protein glycosylation
GO:0097503 IDA:GOC P sialylation

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_200874 Sialic acid metabolism
REACT_22387 Synthesis of substrates in N-glycan biosythesis

Domain Information

InterPro Annotations

Accession Description
IPR001675 Glycosyl transferase, family 29
IPR012163 Sialyltransferase

UniProt Annotations

Entry Information

Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 5
Protein Entry
SIAT9_HUMAN
UniProt ID
Q9UNP4
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q9UNP4-1; Sequence=Displayed; Name=2; IsoId=Q9UNP4-2; Sequence=VSP_033686; Name=3; IsoId=Q9UNP4-3; Sequence=VSP_033687, VSP_033688;
Catalytic Activity CMP-N-acetylneuraminate + beta-D-galactosyl- (1->4)-beta-D-glucosyl-(1<->1)-ceramide = CMP + alpha-N- acetylneuraminyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl- (1<->1)-ceramide.
Disease Amish infantile epilepsy syndrome (AIES) [MIM
Function Catalyzes the formation of ganglioside GM3 (alpha-N- acetylneuraminyl-2,3-beta-D-galactosyl-1, 4-beta-D- glucosylceramide).
Ptm N-glycosylated.
Sequence Caution Sequence=AAD14634.1; Type=Erroneous initiation; Evidence= ; Sequence=AAF66146.1; Type=Erroneous initiation; Evidence= ; Sequence=AAQ89463.1; Type=Erroneous initiation; Evidence= ; Sequence=AAY24147.1; Type=Erroneous gene model prediction; Evidence= ; Sequence=BAA33950.1; Type=Erroneous initiation; Evidence= ;
Similarity Belongs to the glycosyltransferase 29 family.
Subcellular Location Golgi apparatus membrane ; Single-pass type II membrane protein .
Tissue Specificity Ubiquitous. High expression in brain, skeletal muscle, placenta, and testis.
Web Resource Name=Functional Glycomics Gateway - GTase; Note=ST3Gal V; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_hum_626";
Web Resource Name=GGDB; Note=GlycoGene database; URL="http://jcggdb.jp/rcmg/ggdb/Homolog?cat=symbol&symbol=ST3GAL5";

Identical and Related Proteins

Unique RefSeq proteins for LMP000401 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109633044 RefSeq NP_003887 418 lactosylceramide alpha-2,3-sialyltransferase isoform 1
109633046 RefSeq NP_001035902 395 lactosylceramide alpha-2,3-sialyltransferase isoform 2

Identical Sequences to LMP000401 proteins

Reference Database Accession Length Protein Name
GI:109633044 DBBJ BAG50894.1 418 unnamed protein product [Homo sapiens]
GI:109633044 EMBL CAE89320.1 418 unnamed protein product [Homo sapiens]
GI:109633046 GenBank AAO16866.2 395 GM3 synthase [Homo sapiens]
GI:109633044 GenBank EAW99475.1 418 ST3 beta-galactoside alpha-2,3-sialyltransferase 5, isoform CRA_b [Homo sapiens]
GI:109633044 GenBank EAW99479.1 418 ST3 beta-galactoside alpha-2,3-sialyltransferase 5, isoform CRA_b [Homo sapiens]
GI:109633044 SwissProt Q9UNP4.4 418 RecName: Full=Lactosylceramide alpha-2,3-sialyltransferase; AltName: Full=CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase; AltName: Full=Ganglioside GM3 synthase; AltName: Full=ST3Gal V; Short=ST3GalV; AltName: Full=Sialyltransferase 9 [Homo sapiens]

Related Sequences to LMP000401 proteins

Reference Database Accession Length Protein Name
GI:109633046 DBBJ BAG50894.1 418 unnamed protein product [Homo sapiens]
GI:109633046 EMBL CAE89320.1 418 unnamed protein product [Homo sapiens]
GI:109633044 GenBank AAE80032.1 418 Sequence 2 from patent US 6280989
GI:109633044 GenBank AAH65936.2 418 ST3 beta-galactoside alpha-2,3-sialyltransferase 5 [Homo sapiens]
GI:109633046 GenBank EAW99475.1 418 ST3 beta-galactoside alpha-2,3-sialyltransferase 5, isoform CRA_b [Homo sapiens]
GI:109633046 GenBank EAW99479.1 418 ST3 beta-galactoside alpha-2,3-sialyltransferase 5, isoform CRA_b [Homo sapiens]
GI:109633044 GenBank JAA17221.1 418 ST3 beta-galactoside alpha-2,3-sialyltransferase 5 [Pan troglodytes]
GI:109633044 GenBank JAA30634.1 418 ST3 beta-galactoside alpha-2,3-sialyltransferase 5 [Pan troglodytes]
GI:109633044 GenBank JAA40874.1 418 ST3 beta-galactoside alpha-2,3-sialyltransferase 5 [Pan troglodytes]
GI:109633046 RefSeq NP_003887.3 418 lactosylceramide alpha-2,3-sialyltransferase isoform 1 [Homo sapiens]
GI:109633044 RefSeq XP_009440872.1 418 PREDICTED: lactosylceramide alpha-2,3-sialyltransferase isoform X1 [Pan troglodytes]
GI:109633046 SwissProt Q9UNP4.4 418 RecName: Full=Lactosylceramide alpha-2,3-sialyltransferase; AltName: Full=CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase; AltName: Full=Ganglioside GM3 synthase; AltName: Full=ST3Gal V; Short=ST3GalV; AltName: Full=Sialyltransferase 9 [Homo sapiens]