Gene/Proteome Database (LMPD)
LMPD ID
LMP000401
Gene ID
Species
Homo sapiens (Human)
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 5
Gene Symbol
Synonyms
SATI; SIAT9; SIATGM3S; ST3GalV
Alternate Names
lactosylceramide alpha-2,3-sialyltransferase; ST3Gal V; GM3 synthase; ganglioside GM3 synthase; alpha 2,3-sialyltransferase V; CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase; sialyltransferase 9 (CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase; GM3 synthase)
Chromosome
2
Map Location
2p11.2
EC Number
2.4.99.9
Summary
Ganglioside GM3 is known to participate in the induction of cell differentiation, modulation of cell proliferation, maintenance of fibroblast morphology, signal transduction, and integrin-mediated cell adhesion. The protein encoded by this gene is a type II membrane protein which catalyzes the formation of GM3 using lactosylceramide as the substrate. The encoded protein is a member of glycosyltransferase family 29 and may be localized to the Golgi apparatus. Mutation in this gene has been associated with Amish infantile epilepsy syndrome. Transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| lactosylceramide alpha-2,3-sialyltransferase isoform 1 | |
|---|---|
| Refseq ID | NP_003887 |
| Protein GI | 109633044 |
| UniProt ID | Q9UNP4 |
| mRNA ID | NM_003896 |
| Length | 418 |
| RefSeq Status | REVIEWED |
| MRTKAAGCAERRPLQPRTEAAAAPAGRAMPSEYTYVKLRSDCSRPSLQWYTRAQSKMRRPSLLLKDILKCTLLVFGVWILYILKLNYTTEECDMKKMHYVDPDHVKRAQKYAQQVLQKECRPKFAKTSMALLFEHRYSVDLLPFVQKAPKDSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGSGGILHGLELGHTLNQFDVVIRLNSAPVEGYSEHVGNKTTIRMTYPEGAPLSDLEYYSNDLFVAVLFKSVDFNWLQAMVKKETLPFWVRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWGRDKNVPTIGVIAVVLATHLCDEVSLAGFGYDLNQPRTPLHYFDSQCMAAMNFQTMHNVTTETKFLLKLVKEGVVKDLSGGIDREF | |
| lactosylceramide alpha-2,3-sialyltransferase isoform 2 | |
|---|---|
| Refseq ID | NP_001035902 |
| Protein GI | 109633046 |
| UniProt ID | Q9UNP4 |
| mRNA ID | NM_001042437 |
| Length | 395 |
| RefSeq Status | REVIEWED |
| MASVPMPSEYTYVKLRSDCSRPSLQWYTRAQSKMRRPSLLLKDILKCTLLVFGVWILYILKLNYTTEECDMKKMHYVDPDHVKRAQKYAQQVLQKECRPKFAKTSMALLFEHRYSVDLLPFVQKAPKDSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGSGGILHGLELGHTLNQFDVVIRLNSAPVEGYSEHVGNKTTIRMTYPEGAPLSDLEYYSNDLFVAVLFKSVDFNWLQAMVKKETLPFWVRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWGRDKNVPTIGVIAVVLATHLCDEVSLAGFGYDLNQPRTPLHYFDSQCMAAMNFQTMHNVTTETKFLLKLVKEGVVKDLSGGIDREF | |
Gene Information
Entrez Gene ID
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 5
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0000139 | NAS:UniProtKB | C | Golgi membrane |
| GO:0030173 | IEA:InterPro | C | integral component of Golgi membrane |
| GO:0016021 | TAS:ProtInc | C | integral component of membrane |
| GO:0005887 | TAS:ProtInc | C | integral component of plasma membrane |
| GO:0047291 | IDA:UniProtKB | F | lactosylceramide alpha-2,3-sialyltransferase activity |
| GO:0004513 | TAS:ProtInc | F | neolactotetraosylceramide alpha-2,3-sialyltransferase activity |
| GO:0008373 | TAS:ProtInc | F | sialyltransferase activity |
| GO:0005975 | TAS:ProtInc | P | carbohydrate metabolic process |
| GO:0001574 | NAS:UniProtKB | P | ganglioside biosynthetic process |
| GO:0006688 | TAS:ProtInc | P | glycosphingolipid biosynthetic process |
| GO:0006486 | IEA:InterPro | P | protein glycosylation |
| GO:0097503 | IDA:GOC | P | sialylation |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_200874 | Sialic acid metabolism |
| REACT_22387 | Synthesis of substrates in N-glycan biosythesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 5
Protein Entry
SIAT9_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q9UNP4-1; Sequence=Displayed; Name=2; IsoId=Q9UNP4-2; Sequence=VSP_033686; Name=3; IsoId=Q9UNP4-3; Sequence=VSP_033687, VSP_033688; |
| Catalytic Activity | CMP-N-acetylneuraminate + beta-D-galactosyl- (1->4)-beta-D-glucosyl-(1<->1)-ceramide = CMP + alpha-N- acetylneuraminyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl- (1<->1)-ceramide. |
| Disease | Amish infantile epilepsy syndrome (AIES) [MIM |
| Function | Catalyzes the formation of ganglioside GM3 (alpha-N- acetylneuraminyl-2,3-beta-D-galactosyl-1, 4-beta-D- glucosylceramide). |
| Ptm | N-glycosylated. |
| Sequence Caution | Sequence=AAD14634.1; Type=Erroneous initiation; Evidence= ; Sequence=AAF66146.1; Type=Erroneous initiation; Evidence= ; Sequence=AAQ89463.1; Type=Erroneous initiation; Evidence= ; Sequence=AAY24147.1; Type=Erroneous gene model prediction; Evidence= ; Sequence=BAA33950.1; Type=Erroneous initiation; Evidence= ; |
| Similarity | Belongs to the glycosyltransferase 29 family. |
| Subcellular Location | Golgi apparatus membrane ; Single-pass type II membrane protein . |
| Tissue Specificity | Ubiquitous. High expression in brain, skeletal muscle, placenta, and testis. |
| Web Resource | Name=Functional Glycomics Gateway - GTase; Note=ST3Gal V; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_hum_626"; |
| Web Resource | Name=GGDB; Note=GlycoGene database; URL="http://jcggdb.jp/rcmg/ggdb/Homolog?cat=symbol&symbol=ST3GAL5"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP000401 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109633044 | RefSeq | NP_003887 | 418 | lactosylceramide alpha-2,3-sialyltransferase isoform 1 |
| 109633046 | RefSeq | NP_001035902 | 395 | lactosylceramide alpha-2,3-sialyltransferase isoform 2 |
Identical Sequences to LMP000401 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:109633044 | DBBJ | BAG50894.1 | 418 | unnamed protein product [Homo sapiens] |
| GI:109633044 | EMBL | CAE89320.1 | 418 | unnamed protein product [Homo sapiens] |
| GI:109633046 | GenBank | AAO16866.2 | 395 | GM3 synthase [Homo sapiens] |
| GI:109633044 | GenBank | EAW99475.1 | 418 | ST3 beta-galactoside alpha-2,3-sialyltransferase 5, isoform CRA_b [Homo sapiens] |
| GI:109633044 | GenBank | EAW99479.1 | 418 | ST3 beta-galactoside alpha-2,3-sialyltransferase 5, isoform CRA_b [Homo sapiens] |
| GI:109633044 | SwissProt | Q9UNP4.4 | 418 | RecName: Full=Lactosylceramide alpha-2,3-sialyltransferase; AltName: Full=CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase; AltName: Full=Ganglioside GM3 synthase; AltName: Full=ST3Gal V; Short=ST3GalV; AltName: Full=Sialyltransferase 9 [Homo sapiens] |
Related Sequences to LMP000401 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:109633046 | DBBJ | BAG50894.1 | 418 | unnamed protein product [Homo sapiens] |
| GI:109633046 | EMBL | CAE89320.1 | 418 | unnamed protein product [Homo sapiens] |
| GI:109633044 | GenBank | AAE80032.1 | 418 | Sequence 2 from patent US 6280989 |
| GI:109633044 | GenBank | AAH65936.2 | 418 | ST3 beta-galactoside alpha-2,3-sialyltransferase 5 [Homo sapiens] |
| GI:109633046 | GenBank | EAW99475.1 | 418 | ST3 beta-galactoside alpha-2,3-sialyltransferase 5, isoform CRA_b [Homo sapiens] |
| GI:109633046 | GenBank | EAW99479.1 | 418 | ST3 beta-galactoside alpha-2,3-sialyltransferase 5, isoform CRA_b [Homo sapiens] |
| GI:109633044 | GenBank | JAA17221.1 | 418 | ST3 beta-galactoside alpha-2,3-sialyltransferase 5 [Pan troglodytes] |
| GI:109633044 | GenBank | JAA30634.1 | 418 | ST3 beta-galactoside alpha-2,3-sialyltransferase 5 [Pan troglodytes] |
| GI:109633044 | GenBank | JAA40874.1 | 418 | ST3 beta-galactoside alpha-2,3-sialyltransferase 5 [Pan troglodytes] |
| GI:109633046 | RefSeq | NP_003887.3 | 418 | lactosylceramide alpha-2,3-sialyltransferase isoform 1 [Homo sapiens] |
| GI:109633044 | RefSeq | XP_009440872.1 | 418 | PREDICTED: lactosylceramide alpha-2,3-sialyltransferase isoform X1 [Pan troglodytes] |
| GI:109633046 | SwissProt | Q9UNP4.4 | 418 | RecName: Full=Lactosylceramide alpha-2,3-sialyltransferase; AltName: Full=CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase; AltName: Full=Ganglioside GM3 synthase; AltName: Full=ST3Gal V; Short=ST3GalV; AltName: Full=Sialyltransferase 9 [Homo sapiens] |