Gene/Proteome Database (LMPD)

LMPD ID
LMP000402
Gene ID
341
Species
Homo sapiens (Human)
Gene Name
apolipoprotein C-I
Gene Symbol
APOC1
Synonyms
Apo-CI; ApoC-I
Alternate Names
apolipoprotein C-I; apo-CIB; apoC-IB; apolipoprotein C1; apolipoprotein C-I variant I
Chromosome
19
Map Location
19q13.2
Summary
The protein encoded by this gene is a member of the apolipoprotein C1 family. This gene is expressed primarily in the liver, and it is activated when monocytes differentiate into macrophages. A pseudogene of this gene is located 4 kb downstream in the same orientation, on the same chromosome. This gene is mapped to chromosome 19, where it resides within a apolipoprotein gene cluster. Alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for APOC1

Proteins

apolipoprotein C-I precursor
Refseq ID NP_001636
Protein GI 4502157
UniProt ID P02654
mRNA ID NM_001645
Length 83
RefSeq Status REVIEWED
MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS
sig_peptide: 1..26 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2719 peptide sequence: MRLFLSLPVLVVVLSIVLEGPAPAQG mat_peptide: 27..83 product: apolipoprotein C-I calculated_mol_wt: 6631 peptide sequence: TPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS

Gene Information

Entrez Gene ID
341
Gene Name
apolipoprotein C-I
Gene Symbol
APOC1
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0042627 TAS:BHF-UCL C chylomicron
GO:0005783 IDA:LIFEdb C endoplasmic reticulum
GO:0070062 IDA:UniProt C extracellular vesicular exosome
GO:0034364 IDA:BHF-UCL C high-density lipoprotein particle
GO:0034361 IDA:BHF-UCL C very-low-density lipoprotein particle
GO:0005504 IDA:BHF-UCL F fatty acid binding
GO:0055102 IDA:BHF-UCL F lipase inhibitor activity
GO:0031210 TAS:BHF-UCL F phosphatidylcholine binding
GO:0060228 TAS:BHF-UCL F phosphatidylcholine-sterol O-acyltransferase activator activity
GO:0004859 IDA:BHF-UCL F phospholipase inhibitor activity
GO:0033344 IDA:BHF-UCL P cholesterol efflux
GO:0008203 IEA:Ensembl P cholesterol metabolic process
GO:0034382 IDA:BHF-UCL P chylomicron remnant clearance
GO:0034375 TAS:BHF-UCL P high-density lipoprotein particle remodeling
GO:0006629 TAS:ProtInc P lipid metabolic process
GO:0042157 IEA:InterPro P lipoprotein metabolic process
GO:0032375 IDA:BHF-UCL P negative regulation of cholesterol transport
GO:0045717 IDA:BHF-UCL P negative regulation of fatty acid biosynthetic process
GO:0050995 IDA:BHF-UCL P negative regulation of lipid catabolic process
GO:0045833 IDA:BHF-UCL P negative regulation of lipid metabolic process
GO:0051005 IDA:BHF-UCL P negative regulation of lipoprotein lipase activity
GO:0010900 IDA:BHF-UCL P negative regulation of phosphatidylcholine catabolic process
GO:0048261 IDA:BHF-UCL P negative regulation of receptor-mediated endocytosis
GO:0010916 IDA:BHF-UCL P negative regulation of very-low-density lipoprotein particle clearance
GO:0033700 IDA:BHF-UCL P phospholipid efflux
GO:0034369 IDA:BHF-UCL P plasma lipoprotein particle remodeling
GO:0043085 TAS:GOC P positive regulation of catalytic activity
GO:0010873 TAS:BHF-UCL P positive regulation of cholesterol esterification
GO:0032374 IC:BHF-UCL P regulation of cholesterol transport
GO:0006641 IEA:Ensembl P triglyceride metabolic process
GO:0034379 TAS:BHF-UCL P very-low-density lipoprotein particle assembly
GO:0034447 IGI:BHF-UCL P very-low-density lipoprotein particle clearance

Domain Information

InterPro Annotations

Accession Description
IPR006781 Apolipoprotein C-I

UniProt Annotations

Entry Information

Gene Name
apolipoprotein C-I
Protein Entry
APOC1_HUMAN
UniProt ID
P02654
Species
Human

Comments

Comment Type Description
Function Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP). Binds free fatty acids and reduces their intracellular esterification. Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein.
Miscellaneous Apolipoprotein C-I is present in acidic (APOC1A) and basic (APOC1B) forms in P.paniscus, P.abelii and P.troglodytes and perhaps also in baboons and macaques. The two genes for ApoC-I arose through a duplication process that occurred after the divergence of New World monkeys from the human lineage. In human, the acidic form has become a pseudogene sometime between the divergence of bonobos and chimpanzees from the human lineage and the appearance of the Denisovans. Pseudogenization resulted when the codon for the penultimate amino acid in the signal sequence was changed to a stop codon.
Similarity Belongs to the apolipoprotein C1 family.
Subcellular Location Secreted .
Tissue Specificity Synthesized mainly in liver and to a minor degree in intestine. Also found in the lung and spleen.
Web Resource Name=Wikipedia; Note=Apolipoprotein C1 entry; URL="http://en.wikipedia.org/wiki/Apolipoprotein_C1";

Identical and Related Proteins

Unique RefSeq proteins for LMP000402 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4502157 RefSeq NP_001636 83 apolipoprotein C-I precursor

Identical Sequences to LMP000402 proteins

Reference Database Accession Length Protein Name
GI:4502157 DBBJ BAI46533.1 83 apolipoprotein C-I, partial [synthetic construct]
GI:4502157 GenBank ACT64519.1 83 apolipoprotein C-I protein, partial [synthetic construct]
GI:4502157 GenBank AFQ78689.1 83 Sequence 5 from patent US 8241861
GI:4502157 GenBank AGP16942.1 83 Sequence 5 from patent US 8460889
GI:4502157 GenBank AHD69372.1 83 Sequence 386 from patent US 8586006
GI:4502157 RefSeq XP_005258912.1 83 PREDICTED: apolipoprotein C-I isoform X1 [Homo sapiens]

Related Sequences to LMP000402 proteins

Reference Database Accession Length Protein Name
GI:4502157 EMBL CAD61385.1 83 unnamed protein product [Homo sapiens]
GI:4502157 EMBL CAD61551.1 83 unnamed protein product [Homo sapiens]
GI:4502157 GenBank AAP36875.1 84 Homo sapiens apolipoprotein C-I, partial [synthetic construct]
GI:4502157 GenBank AAX43590.1 84 apolipoprotein C-I, partial [synthetic construct]
GI:4502157 GenBank AAX43591.1 84 apolipoprotein C-I, partial [synthetic construct]
GI:4502157 RefSeq XP_003316492.1 83 PREDICTED: apolipoprotein C-I, basic form [Pan troglodytes]