Gene/Proteome Database (LMPD)

LMPD ID
LMP000405
Gene ID
344
Species
Homo sapiens (Human)
Gene Name
apolipoprotein C-II
Gene Symbol
APOC2
Synonyms
APO-CII; APOC-II
Alternate Names
apolipoprotein C-II; apolipoprotein C2
Chromosome
19
Map Location
19q13.2
Summary
This gene encodes a lipid-binding protein belonging to the apolipoprotein gene family. The protein is secreted in plasma where it is a component of very low density lipoprotein. This protein activates the enzyme lipoprotein lipase, which hydrolyzes triglycerides and thus provides free fatty acids for cells. Mutations in this gene cause hyperlipoproteinemia type IB, characterized by hypertriglyceridemia, xanthomas, and increased risk of pancreatitis and early atherosclerosis. This gene is present in a cluster with other related apolipoprotein genes on chromosome 19. Naturally occurring read-through transcription exists between this gene and the neighboring upstream apolipoprotein C-IV (APOC4) gene. [provided by RefSeq, Mar 2011]
Orthologs
View orthologs and multiple alignments for APOC2

Proteins

apolipoprotein C-II precursor
Refseq ID NP_000474
Protein GI 32130518
UniProt ID P02655
mRNA ID NM_000483
Length 101
RefSeq Status REVIEWED
MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE
sig_peptide: 1..22 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P02655.1) calculated_mol_wt: 2387 peptide sequence: MGTRLLPALFLVLLVLGFEVQG mat_peptide: 23..101 product: Apolipoprotein C-II experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P02655.1) calculated_mol_wt: 8915 peptide sequence: TQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE

Gene Information

Entrez Gene ID
344
Gene Name
apolipoprotein C-II
Gene Symbol
APOC2
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0042627 IDA:BHF-UCL C chylomicron
GO:0005769 TAS:Reactome C early endosome
GO:0005576 NAS:UniProtKB C extracellular region
GO:0005615 IDA:BHF-UCL C extracellular space
GO:0070062 IDA:UniProt C extracellular vesicular exosome
GO:0034363 IDA:BHF-UCL C intermediate-density lipoprotein particle
GO:0034362 IDA:BHF-UCL C low-density lipoprotein particle
GO:0034366 IDA:BHF-UCL C spherical high-density lipoprotein particle
GO:0034361 IDA:BHF-UCL C very-low-density lipoprotein particle
GO:0055102 IDA:BHF-UCL F lipase inhibitor activity
GO:0008289 IDA:BHF-UCL F lipid binding
GO:0060230 IDA:BHF-UCL F lipoprotein lipase activator activity
GO:0016004 IDA:BHF-UCL F phospholipase activator activity
GO:0043274 IPI:BHF-UCL F phospholipase binding
GO:0042803 IMP:BHF-UCL F protein homodimerization activity
GO:0033344 IDA:BHF-UCL P cholesterol efflux
GO:0042632 IC:BHF-UCL P cholesterol homeostasis
GO:0034382 IDA:BHF-UCL P chylomicron remnant clearance
GO:0034371 IC:BHF-UCL P chylomicron remodeling
GO:0034384 IMP:BHF-UCL P high-density lipoprotein particle clearance
GO:0016042 IEA:UniProtKB-KW P lipid catabolic process
GO:0042157 TAS:Reactome P lipoprotein metabolic process
GO:0043086 IDA:GOC P negative regulation of catalytic activity
GO:0032375 IMP:BHF-UCL P negative regulation of cholesterol transport
GO:0045833 IDA:BHF-UCL P negative regulation of lipid metabolic process
GO:0048261 IDA:BHF-UCL P negative regulation of receptor-mediated endocytosis
GO:0010916 IDA:BHF-UCL P negative regulation of very-low-density lipoprotein particle clearance
GO:0033700 IDA:BHF-UCL P phospholipid efflux
GO:0007603 TAS:Reactome P phototransduction, visible light
GO:0045723 IDA:BHF-UCL P positive regulation of fatty acid biosynthetic process
GO:0051006 IDA:BHF-UCL P positive regulation of lipoprotein lipase activity
GO:0010518 IDA:BHF-UCL P positive regulation of phospholipase activity
GO:0060697 IDA:BHF-UCL P positive regulation of phospholipid catabolic process
GO:0010898 IDA:BHF-UCL P positive regulation of triglyceride catabolic process
GO:0010902 IC:BHF-UCL P positive regulation of very-low-density lipoprotein particle remodeling
GO:0001523 TAS:Reactome P retinoid metabolic process
GO:0043691 IC:BHF-UCL P reverse cholesterol transport
GO:0044281 TAS:Reactome P small molecule metabolic process
GO:0070328 IMP:BHF-UCL P triglyceride homeostasis
GO:0034370 TAS:BHF-UCL P triglyceride-rich lipoprotein particle remodeling
GO:0034372 TAS:BHF-UCL P very-low-density lipoprotein particle remodeling

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_6841 Chylomicron-mediated lipid transport
REACT_13621 HDL-mediated lipid transport
REACT_24968 Retinoid metabolism and transport

Domain Information

InterPro Annotations

Accession Description
IPR023121 ApoC-II domain
IPR008019 Apolipoprotein C-II

UniProt Annotations

Entry Information

Gene Name
apolipoprotein C-II
Protein Entry
APOC2_HUMAN
UniProt ID
P02655
Species
Human

Comments

Comment Type Description
Disease Hyperlipoproteinemia 1B (HLPP1B) [MIM
Function Component of chylomicrons, very low-density lipoproteins (VLDL), low-density lipoproteins (LDL), and high-density lipoproteins (HDL) in plasma. Plays an important role in lipoprotein metabolism as an activator of lipoprotein lipase. Both proapolipoprotein C-II and apolipoprotein C-II can activate lipoprotein lipase. In normolipidemic individuals, it is mainly distributed in the HDL, whereas in hypertriglyceridemic individuals, predominantly found in the VLDL and LDL.
Ptm Proapolipoprotein C-II is synthesized as a sialic acid containing glycoprotein which is subsequently desialylated prior to its proteolytic processing.
Ptm Proapolipoprotein C-II, the major form found in plasma undergoes proteolytic cleavage of its N-terminal hexapeptide to generate apolipoprotein C-II, which occurs as the minor form in plasma.
Similarity Belongs to the apolipoprotein C2 family.
Subcellular Location Secreted .
Tissue Specificity Liver and intestine.

Identical and Related Proteins

Unique RefSeq proteins for LMP000405 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
32130518 RefSeq NP_000474 101 apolipoprotein C-II precursor

Identical Sequences to LMP000405 proteins

Reference Database Accession Length Protein Name
GI:32130518 GenBank EAW57313.1 101 apolipoprotein C-II, isoform CRA_a [Homo sapiens]
GI:32130518 GenBank ACM81716.1 101 Sequence 7214 from patent US 6812339
GI:32130518 GenBank ACN81313.1 101 apolipoprotein C-II [Homo sapiens]
GI:32130518 GenBank AEK13840.1 101 Sequence 9 from patent US 7972802
GI:32130518 GenBank AGM56993.1 101 Sequence 9 from patent US 8420337
GI:32130518 GenBank AHE01110.1 101 Sequence 56026 from patent US 8586006

Related Sequences to LMP000405 proteins

Reference Database Accession Length Protein Name
GI:32130518 GenBank AAP35354.1 101 apolipoprotein C-II [Homo sapiens]
GI:32130518 GenBank AAH05348.3 101 Apolipoprotein C-II [Homo sapiens]
GI:32130518 GenBank ACE87064.1 101 apolipoprotein C-II protein, partial [synthetic construct]
GI:32130518 GenBank ACE87745.1 101 apolipoprotein C-II protein [synthetic construct]
GI:32130518 GenBank AGB62518.1 236 Sequence 79 from patent US 8288091
GI:32130518 GenBank AGB62524.1 123 Sequence 85 from patent US 8288091