Gene/Proteome Database (LMPD)

LMPD ID
LMP000407
Gene ID
345
Species
Homo sapiens (Human)
Gene Name
apolipoprotein C-III
Gene Symbol
APOC3
Synonyms
APOCIII; HALP2
Chromosome
11
Map Location
11q23.3
Summary
Apolipoprotein C-III is a very low density lipoprotein (VLDL) protein. APOC3 inhibits lipoprotein lipase and hepatic lipase; it is thought to delay catabolism of triglyceride-rich particles. The APOA1, APOC3 and APOA4 genes are closely linked in both rat and human genomes. The A-I and A-IV genes are transcribed from the same strand, while the A-1 and C-III genes are convergently transcribed. An increase in apoC-III levels induces the development of hypertriglyceridemia. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for APOC3

Proteins

apolipoprotein C-III precursor
Refseq ID NP_000031
Protein GI 4557323
UniProt ID P02656
mRNA ID NM_000040
Length 99
RefSeq Status REVIEWED
MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
sig_peptide: 1..20 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2106 peptide sequence: MQPRVLLVVALLALLASARA mat_peptide: 21..99 product: apolipoprotein C-III calculated_mol_wt: 8765 peptide sequence: SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA

Gene Information

Entrez Gene ID
345
Gene Name
apolipoprotein C-III
Gene Symbol
APOC3
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005615 IEA:Ensembl C extracellular space
GO:0008289 IEA:InterPro F lipid binding
GO:0071333 IEA:Ensembl P cellular response to glucose stimulus
GO:0008203 IEA:Ensembl P cholesterol metabolic process
GO:0006954 IEA:Ensembl P inflammatory response
GO:0006869 IEA:InterPro P lipid transport
GO:0042157 IEA:InterPro P lipoprotein metabolic process
GO:0042953 IEA:Ensembl P lipoprotein transport
GO:0042493 IEA:Ensembl P response to drug
GO:0007584 IEA:Ensembl P response to nutrient
GO:0043434 IEA:Ensembl P response to peptide hormone
GO:0019433 IEA:Ensembl P triglyceride catabolic process
GO:0006642 IEA:Ensembl P triglyceride mobilization

KEGG Pathway Links

KEGG Pathway ID Description
hsa03320 PPAR signaling pathway

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_13621 HDL-mediated lipid transport
REACT_24968 Retinoid metabolism and transport

Domain Information

InterPro Annotations

Accession Description
IPR008403 Apolipoprotein CIII

UniProt Annotations

Entry Information

Gene Name
apolipoprotein C-III
Protein Entry
APOC3_HUMAN
UniProt ID
P02656
Species
Human

Identical and Related Proteins

Unique RefSeq proteins for LMP000407 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4557323 RefSeq NP_000031 99 apolipoprotein C-III precursor

Identical Sequences to LMP000407 proteins

Reference Database Accession Length Protein Name
GI:4557323 EMBL CDM21968.1 99 unnamed protein product [Homo sapiens]
GI:4557323 GenBank AGP16943.1 99 Sequence 6 from patent US 8460889
GI:4557323 GenBank AGU37453.1 99 Sequence 2 from patent US 8507444
GI:4557323 GenBank AGY24865.1 99 Sequence 2 from patent US 8557513
GI:4557323 GenBank AIC48278.1 99 APOC3, partial [synthetic construct]
GI:4557323 GenBank AIC54021.1 99 APOC3, partial [synthetic construct]

Related Sequences to LMP000407 proteins

Reference Database Accession Length Protein Name
GI:4557323 GenBank AAB59372.1 99 apolipoprotein C-III [Homo sapiens]
GI:4557323 GenBank ACA05941.1 117 apolipoprotein C-III precursor variant 1 [Homo sapiens]
GI:4557323 GenBank AGB62525.1 153 Sequence 86 from patent US 8288091
GI:4557323 RefSeq XP_529442.3 99 PREDICTED: apolipoprotein C-III [Pan troglodytes]
GI:4557323 RefSeq XP_004052228.1 99 PREDICTED: apolipoprotein C-III isoform 1 [Gorilla gorilla gorilla]
GI:4557323 RefSeq XP_004052229.1 117 PREDICTED: apolipoprotein C-III isoform 2 [Gorilla gorilla gorilla]