Gene/Proteome Database (LMPD)
LMPD ID
LMP000426
Gene ID
Species
Homo sapiens (Human)
Gene Name
peroxisome proliferator-activated receptor delta
Gene Symbol
Synonyms
FAAR; NR1C2; NUC1; NUCI; NUCII; PPARB
Chromosome
6
Map Location
6p21.2
Summary
This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) family. PPARs are nuclear hormone receptors that bind peroxisome proliferators and control the size and number of peroxisomes produced by cells. PPARs mediate a variety of biological processes, and may be involved in the development of several chronic diseases, including diabetes, obesity, atherosclerosis, and cancer. This protein is a potent inhibitor of ligand-induced transcription activity of PPAR alpha and PPAR gamma. It may function as an integrator of transcription repression and nuclear receptor signaling. The expression of this gene is found to be elevated in colorectal cancer cells. The elevated expression can be repressed by adenomatosis polyposis coli (APC), a tumor suppressor protein related to APC/beta-catenin signaling pathway. Knockout studies in mice suggested the role of this protein in myelination of the corpus callosum, lipid metabolism, and epidermal cell proliferation. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2010]
Orthologs
Proteins
peroxisome proliferator-activated receptor delta isoform 1 | |
---|---|
Refseq ID | NP_001165289 |
Protein GI | 284807155 |
UniProt ID | Q03181 |
mRNA ID | NM_001171818 |
Length | 441 |
RefSeq Status | REVIEWED |
MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQMGCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY |
peroxisome proliferator-activated receptor delta isoform 1 | |
---|---|
Refseq ID | NP_006229 |
Protein GI | 5453940 |
UniProt ID | Q03181 |
mRNA ID | NM_006238 |
Length | 441 |
RefSeq Status | REVIEWED |
Protein sequence is identical to GI:284807155 (mRNA isoform) |
peroxisome proliferator-activated receptor delta isoform 2 | |
---|---|
Refseq ID | NP_803184 |
Protein GI | 29171750 |
UniProt ID | Q03181 |
mRNA ID | NM_177435 |
Length | 361 |
RefSeq Status | REVIEWED |
MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQMGCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGGE |
peroxisome proliferator-activated receptor delta isoform 3 | |
---|---|
Refseq ID | NP_001165290 |
Protein GI | 284807157 |
UniProt ID | Q03181 |
mRNA ID | NM_001171819 |
Length | 402 |
RefSeq Status | REVIEWED |
MHQRDLSRSSSPPSLLDQLQMGCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY |
peroxisome proliferator-activated receptor delta isoform 4 | |
---|---|
Refseq ID | NP_001165291 |
Protein GI | 284807157 |
UniProt ID | Q03181 |
mRNA ID | NM_001171820 |
Length | 402 |
RefSeq Status | REVIEWED |
MHQRDLSRSSSPPSLLDQLQMGCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY |
Gene Information
Entrez Gene ID
Gene Name
peroxisome proliferator-activated receptor delta
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005654 | TAS:Reactome | C | nucleoplasm |
GO:0005634 | NAS:UniProtKB | C | nucleus |
GO:0003677 | ISS:UniProtKB | F | DNA binding |
GO:0008144 | IDA:UniProtKB | F | drug binding |
GO:0004879 | IDA:UniProtKB | F | ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity |
GO:0070539 | IDA:UniProtKB | F | linoleic acid binding |
GO:0008289 | IDA:UniProtKB | F | lipid binding |
GO:0043565 | IEA:InterPro | F | sequence-specific DNA binding |
GO:0003700 | IDA:UniProtKB | F | sequence-specific DNA binding transcription factor activity |
GO:0003707 | TAS:ProtInc | F | steroid hormone receptor activity |
GO:0003713 | IEA:Ensembl | F | transcription coactivator activity |
GO:0008270 | IEA:InterPro | F | zinc ion binding |
GO:0060612 | IEA:Ensembl | P | adipose tissue development |
GO:0042640 | IEA:Ensembl | P | anagen |
GO:0097190 | IMP:UniProtKB | P | apoptotic signaling pathway |
GO:0008366 | ISS:UniProtKB | P | axon ensheathment |
GO:0030154 | IEA:Ensembl | P | cell differentiation |
GO:0008283 | ISS:UniProtKB | P | cell proliferation |
GO:0031589 | IEA:Ensembl | P | cell-substrate adhesion |
GO:0071456 | IEA:Ensembl | P | cellular response to hypoxia |
GO:0008203 | TAS:UniProtKB | P | cholesterol metabolic process |
GO:0046697 | TAS:UniProtKB | P | decidualization |
GO:0007566 | TAS:UniProtKB | P | embryo implantation |
GO:0006635 | ISS:UniProtKB | P | fatty acid beta-oxidation |
GO:0009062 | TAS:UniProtKB | P | fatty acid catabolic process |
GO:0015908 | ISS:UniProtKB | P | fatty acid transport |
GO:0010467 | TAS:Reactome | P | gene expression |
GO:0006091 | TAS:ProtInc | P | generation of precursor metabolites and energy |
GO:0006006 | NAS:UniProtKB | P | glucose metabolic process |
GO:0015758 | NAS:UniProtKB | P | glucose transport |
GO:0007507 | IEA:Ensembl | P | heart development |
GO:0030522 | IDA:GOC | P | intracellular receptor signaling pathway |
GO:0051546 | IEA:Ensembl | P | keratinocyte migration |
GO:0043616 | IEA:Ensembl | P | keratinocyte proliferation |
GO:0006629 | ISS:UniProtKB | P | lipid metabolic process |
GO:0009299 | IEA:Ensembl | P | mRNA transcription |
GO:0043066 | IEA:Ensembl | P | negative regulation of apoptotic process |
GO:0030308 | IEA:Ensembl | P | negative regulation of cell growth |
GO:0032966 | IEA:Ensembl | P | negative regulation of collagen biosynthetic process |
GO:0050680 | IEA:Ensembl | P | negative regulation of epithelial cell proliferation |
GO:0050728 | IEA:Ensembl | P | negative regulation of inflammatory response |
GO:0014912 | IEA:Ensembl | P | negative regulation of smooth muscle cell migration |
GO:0048662 | IEA:Ensembl | P | negative regulation of smooth muscle cell proliferation |
GO:0045892 | ISS:UniProtKB | P | negative regulation of transcription, DNA-templated |
GO:0000122 | ISS:UniProtKB | P | negative regulation of transcription from RNA polymerase II promoter |
GO:0008654 | IEA:Ensembl | P | phospholipid biosynthetic process |
GO:0008284 | IEA:Ensembl | P | positive regulation of cell proliferation |
GO:0045684 | IEA:Ensembl | P | positive regulation of epidermis development |
GO:0045600 | NAS:UniProtKB | P | positive regulation of fat cell differentiation |
GO:0032024 | IEA:Ensembl | P | positive regulation of insulin secretion |
GO:0014068 | IEA:Ensembl | P | positive regulation of phosphatidylinositol 3-kinase signaling |
GO:0045893 | IDA:UniProtKB | P | positive regulation of transcription, DNA-templated |
GO:0045909 | IEA:Ensembl | P | positive regulation of vasodilation |
GO:0006029 | IEA:Ensembl | P | proteoglycan metabolic process |
GO:0006357 | TAS:ProtInc | P | regulation of transcription from RNA polymerase II promoter |
GO:0014823 | IEA:Ensembl | P | response to activity |
GO:0009749 | IEA:Ensembl | P | response to glucose |
GO:0033189 | IEA:Ensembl | P | response to vitamin A |
GO:0006367 | TAS:Reactome | P | transcription initiation from RNA polymerase II promoter |
GO:0006776 | IEA:Ensembl | P | vitamin A metabolic process |
GO:0042060 | IEA:Ensembl | P | wound healing |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
hsa05221 | Acute myeloid leukemia |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR008946 | Nuclear hormone receptor, ligand-binding |
IPR000536 | Nuclear hormone receptor, ligand-binding, core |
IPR003074 | Peroxisome proliferator-activated receptor |
IPR003075 | Peroxisome proliferator-activated receptor, beta |
IPR001723 | Steroid hormone receptor |
IPR013088 | Zinc finger, NHR/GATA-type |
IPR001628 | Zinc finger, nuclear hormone receptor-type |
UniProt Annotations
Entry Information
Gene Name
peroxisome proliferator-activated receptor delta
Protein Entry
PPARD_HUMAN
UniProt ID
Species
Human
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=Q03181-1; Sequence=Displayed; Name=2; IsoId=Q03181-2; Sequence=VSP_010133, VSP_010134; Name=3; IsoId=Q03181-3; Sequence=VSP_043787; Name=4; IsoId=Q03181-4; Sequence=VSP_046104; Note=No experimental confirmation available.; |
Function | Ligand-activated transcription factor. Receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Has a preference for poly-unsaturated fatty acids, such as gamma-linoleic acid and eicosapentanoic acid. Once activated by a ligand, the receptor binds to promoter elements of target genes. Regulates the peroxisomal beta-oxidation pathway of fatty acids. Functions as transcription activator for the acyl-CoA oxidase gene. Decreases expression of NPC1L1 once activated by a ligand. |
Interaction | O60341:KDM1A; NbExp=2; IntAct=EBI-6426768, EBI-710124; |
Similarity | Belongs to the nuclear hormone receptor family. NR1 subfamily. |
Similarity | Contains 1 nuclear receptor DNA-binding domain. |
Subcellular Location | Nucleus. |
Subunit | Heterodimer with the retinoid X receptor. {ECO |
Tissue Specificity | Ubiquitous with maximal levels in placenta and skeletal muscle. |
Web Resource | Name=Atlas of Genetics and Cytogenetics in Oncology and Haematology; URL="http://atlasgeneticsoncology.org/Genes/PPARDID41794ch6p21.html"; |
Web Resource | Name=NIEHS-SNPs; URL="http://egp.gs.washington.edu/data/ppard/"; |
Web Resource | Name=Wikipedia; Note=Peroxisome proliferator- activated receptor entry; URL="http://en.wikipedia.org/wiki/Peroxisome_proliferator-activated_receptor"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP000426 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
284807155 | RefSeq | NP_001165289 | 441 | peroxisome proliferator-activated receptor delta isoform 1 |
29171750 | RefSeq | NP_803184 | 361 | peroxisome proliferator-activated receptor delta isoform 2 |
284807157 | RefSeq | NP_001165290 | 402 | peroxisome proliferator-activated receptor delta isoform 3 |
284807157 | RefSeq | NP_001165291 | 402 | peroxisome proliferator-activated receptor delta isoform 4 |
Identical Sequences to LMP000426 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:284807157 | DBBJ | BAH12347.1 | 402 | unnamed protein product [Homo sapiens] |
GI:284807157 | DBBJ | BAH12347.1 | 402 | unnamed protein product [Homo sapiens] |
GI:29171750 | GenBank | AAH02715.1 | 361 | PPARD protein [Homo sapiens] |
GI:29171750 | GenBank | AAH07578.1 | 361 | PPARD protein [Homo sapiens] |
GI:29171750 | GenBank | EAX03826.1 | 361 | peroxisome proliferative activated receptor, delta, isoform CRA_b [Homo sapiens] |
GI:29171750 | GenBank | ADZ17376.1 | 361 | peroxisome proliferator-activated nuclear receptor beta/delta variant 2 [Homo sapiens] |
GI:29171750 | GenBank | JAA06097.1 | 361 | peroxisome proliferator-activated receptor delta [Pan troglodytes] |
GI:284807155 | GenBank | AHE19864.1 | 441 | Sequence 40 from patent US 8574635 |
GI:29171750 | GenBank | AIC54929.1 | 361 | PPARD, partial [synthetic construct] |
GI:284807155 | RefSeq | XP_005249250.1 | 441 | PREDICTED: peroxisome proliferator-activated receptor delta isoform X3 [Homo sapiens] |
GI:284807155 | RefSeq | XP_006715183.1 | 441 | PREDICTED: peroxisome proliferator-activated receptor delta isoform X5 [Homo sapiens] |
GI:284807155 | RefSeq | XP_006715184.1 | 441 | PREDICTED: peroxisome proliferator-activated receptor delta isoform X6 [Homo sapiens] |
GI:284807155 | RefSeq | XP_006715185.1 | 441 | PREDICTED: peroxisome proliferator-activated receptor delta isoform X7 [Homo sapiens] |
GI:284807155 | RefSeq | XP_006715186.1 | 441 | PREDICTED: peroxisome proliferator-activated receptor delta isoform X8 [Homo sapiens] |
Related Sequences to LMP000426 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:29171750 | GenBank | AAP36130.1 | 362 | Homo sapiens peroxisome proliferative activated receptor, delta, partial [synthetic construct] |
GI:29171750 | GenBank | AAX29360.1 | 362 | peroxisome proliferative activated receptor delta, partial [synthetic construct] |
GI:29171750 | GenBank | AAX29361.1 | 362 | peroxisome proliferative activated receptor delta, partial [synthetic construct] |
GI:284807157 | GenBank | ACM86099.1 | 500 | Sequence 11597 from patent US 6812339 |
GI:284807155 | GenBank | ACM86099.1 | 500 | Sequence 11597 from patent US 6812339 |
GI:284807157 | GenBank | ACM86099.1 | 500 | Sequence 11597 from patent US 6812339 |
GI:29171750 | GenBank | AFH29701.1 | 361 | peroxisome proliferator-activated receptor delta isoform 2 [Macaca mulatta] |
GI:29171750 | GenBank | AFI33298.1 | 361 | peroxisome proliferator-activated receptor delta isoform 2 [Macaca mulatta] |
GI:284807155 | RefSeq | XP_518905.2 | 441 | PREDICTED: peroxisome proliferator-activated receptor delta isoform X1 [Pan troglodytes] |
GI:284807157 | RefSeq | XP_003789173.1 | 402 | PREDICTED: peroxisome proliferator-activated receptor delta isoform 2 [Otolemur garnettii] |
GI:284807157 | RefSeq | XP_003789173.1 | 402 | PREDICTED: peroxisome proliferator-activated receptor delta isoform 2 [Otolemur garnettii] |
GI:284807157 | RefSeq | XP_004424286.1 | 402 | PREDICTED: peroxisome proliferator-activated receptor delta isoform 2 [Ceratotherium simum simum] |
GI:284807157 | RefSeq | XP_004424286.1 | 402 | PREDICTED: peroxisome proliferator-activated receptor delta isoform 2 [Ceratotherium simum simum] |
GI:284807155 | RefSeq | XP_009449383.1 | 441 | PREDICTED: peroxisome proliferator-activated receptor delta isoform X1 [Pan troglodytes] |
GI:284807155 | RefSeq | XP_009449384.1 | 441 | PREDICTED: peroxisome proliferator-activated receptor delta isoform X1 [Pan troglodytes] |
GI:284807155 | RefSeq | XP_009449385.1 | 441 | PREDICTED: peroxisome proliferator-activated receptor delta isoform X1 [Pan troglodytes] |
GI:284807155 | RefSeq | XP_009449386.1 | 441 | PREDICTED: peroxisome proliferator-activated receptor delta isoform X1 [Pan troglodytes] |
GI:29171750 | RefSeq | XP_009449387.1 | 380 | PREDICTED: peroxisome proliferator-activated receptor delta isoform X2 [Pan troglodytes] |
GI:284807157 | RefSeq | XP_010387950.1 | 441 | PREDICTED: peroxisome proliferator-activated receptor delta isoform X1 [Rhinopithecus roxellana] |
GI:284807157 | RefSeq | XP_010387950.1 | 441 | PREDICTED: peroxisome proliferator-activated receptor delta isoform X1 [Rhinopithecus roxellana] |
GI:284807157 | RefSeq | XP_010387951.1 | 441 | PREDICTED: peroxisome proliferator-activated receptor delta isoform X1 [Rhinopithecus roxellana] |
GI:284807157 | RefSeq | XP_010387951.1 | 441 | PREDICTED: peroxisome proliferator-activated receptor delta isoform X1 [Rhinopithecus roxellana] |
GI:284807157 | RefSeq | XP_010387952.1 | 441 | PREDICTED: peroxisome proliferator-activated receptor delta isoform X1 [Rhinopithecus roxellana] |
GI:284807157 | RefSeq | XP_010387952.1 | 441 | PREDICTED: peroxisome proliferator-activated receptor delta isoform X1 [Rhinopithecus roxellana] |