Gene/Proteome Database (LMPD)

LMPD ID
LMP000426
Gene ID
5467
Species
Homo sapiens (Human)
Gene Name
peroxisome proliferator-activated receptor delta
Gene Symbol
PPARD
Synonyms
FAAR; NR1C2; NUC1; NUCI; NUCII; PPARB
Chromosome
6
Map Location
6p21.2
Summary
This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) family. PPARs are nuclear hormone receptors that bind peroxisome proliferators and control the size and number of peroxisomes produced by cells. PPARs mediate a variety of biological processes, and may be involved in the development of several chronic diseases, including diabetes, obesity, atherosclerosis, and cancer. This protein is a potent inhibitor of ligand-induced transcription activity of PPAR alpha and PPAR gamma. It may function as an integrator of transcription repression and nuclear receptor signaling. The expression of this gene is found to be elevated in colorectal cancer cells. The elevated expression can be repressed by adenomatosis polyposis coli (APC), a tumor suppressor protein related to APC/beta-catenin signaling pathway. Knockout studies in mice suggested the role of this protein in myelination of the corpus callosum, lipid metabolism, and epidermal cell proliferation. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2010]
Orthologs
View orthologs and multiple alignments for PPARD

Proteins

peroxisome proliferator-activated receptor delta isoform 1
Refseq ID NP_001165289
Protein GI 284807155
UniProt ID Q03181
mRNA ID NM_001171818
Length 441
RefSeq Status REVIEWED
MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQMGCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY
peroxisome proliferator-activated receptor delta isoform 1
Refseq ID NP_006229
Protein GI 5453940
UniProt ID Q03181
mRNA ID NM_006238
Length 441
RefSeq Status REVIEWED
Protein sequence is identical to GI:284807155 (mRNA isoform)
peroxisome proliferator-activated receptor delta isoform 2
Refseq ID NP_803184
Protein GI 29171750
UniProt ID Q03181
mRNA ID NM_177435
Length 361
RefSeq Status REVIEWED
MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQMGCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGGE
peroxisome proliferator-activated receptor delta isoform 3
Refseq ID NP_001165290
Protein GI 284807157
UniProt ID Q03181
mRNA ID NM_001171819
Length 402
RefSeq Status REVIEWED
MHQRDLSRSSSPPSLLDQLQMGCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY
peroxisome proliferator-activated receptor delta isoform 4
Refseq ID NP_001165291
Protein GI 284807157
UniProt ID Q03181
mRNA ID NM_001171820
Length 402
RefSeq Status REVIEWED
MHQRDLSRSSSPPSLLDQLQMGCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY

Gene Information

Entrez Gene ID
5467
Gene Name
peroxisome proliferator-activated receptor delta
Gene Symbol
PPARD
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005654 TAS:Reactome C nucleoplasm
GO:0005634 NAS:UniProtKB C nucleus
GO:0003677 ISS:UniProtKB F DNA binding
GO:0008144 IDA:UniProtKB F drug binding
GO:0004879 IDA:UniProtKB F ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity
GO:0070539 IDA:UniProtKB F linoleic acid binding
GO:0008289 IDA:UniProtKB F lipid binding
GO:0043565 IEA:InterPro F sequence-specific DNA binding
GO:0003700 IDA:UniProtKB F sequence-specific DNA binding transcription factor activity
GO:0003707 TAS:ProtInc F steroid hormone receptor activity
GO:0003713 IEA:Ensembl F transcription coactivator activity
GO:0008270 IEA:InterPro F zinc ion binding
GO:0060612 IEA:Ensembl P adipose tissue development
GO:0042640 IEA:Ensembl P anagen
GO:0097190 IMP:UniProtKB P apoptotic signaling pathway
GO:0008366 ISS:UniProtKB P axon ensheathment
GO:0030154 IEA:Ensembl P cell differentiation
GO:0008283 ISS:UniProtKB P cell proliferation
GO:0031589 IEA:Ensembl P cell-substrate adhesion
GO:0071456 IEA:Ensembl P cellular response to hypoxia
GO:0008203 TAS:UniProtKB P cholesterol metabolic process
GO:0046697 TAS:UniProtKB P decidualization
GO:0007566 TAS:UniProtKB P embryo implantation
GO:0006635 ISS:UniProtKB P fatty acid beta-oxidation
GO:0009062 TAS:UniProtKB P fatty acid catabolic process
GO:0015908 ISS:UniProtKB P fatty acid transport
GO:0010467 TAS:Reactome P gene expression
GO:0006091 TAS:ProtInc P generation of precursor metabolites and energy
GO:0006006 NAS:UniProtKB P glucose metabolic process
GO:0015758 NAS:UniProtKB P glucose transport
GO:0007507 IEA:Ensembl P heart development
GO:0030522 IDA:GOC P intracellular receptor signaling pathway
GO:0051546 IEA:Ensembl P keratinocyte migration
GO:0043616 IEA:Ensembl P keratinocyte proliferation
GO:0006629 ISS:UniProtKB P lipid metabolic process
GO:0009299 IEA:Ensembl P mRNA transcription
GO:0043066 IEA:Ensembl P negative regulation of apoptotic process
GO:0030308 IEA:Ensembl P negative regulation of cell growth
GO:0032966 IEA:Ensembl P negative regulation of collagen biosynthetic process
GO:0050680 IEA:Ensembl P negative regulation of epithelial cell proliferation
GO:0050728 IEA:Ensembl P negative regulation of inflammatory response
GO:0014912 IEA:Ensembl P negative regulation of smooth muscle cell migration
GO:0048662 IEA:Ensembl P negative regulation of smooth muscle cell proliferation
GO:0045892 ISS:UniProtKB P negative regulation of transcription, DNA-templated
GO:0000122 ISS:UniProtKB P negative regulation of transcription from RNA polymerase II promoter
GO:0008654 IEA:Ensembl P phospholipid biosynthetic process
GO:0008284 IEA:Ensembl P positive regulation of cell proliferation
GO:0045684 IEA:Ensembl P positive regulation of epidermis development
GO:0045600 NAS:UniProtKB P positive regulation of fat cell differentiation
GO:0032024 IEA:Ensembl P positive regulation of insulin secretion
GO:0014068 IEA:Ensembl P positive regulation of phosphatidylinositol 3-kinase signaling
GO:0045893 IDA:UniProtKB P positive regulation of transcription, DNA-templated
GO:0045909 IEA:Ensembl P positive regulation of vasodilation
GO:0006029 IEA:Ensembl P proteoglycan metabolic process
GO:0006357 TAS:ProtInc P regulation of transcription from RNA polymerase II promoter
GO:0014823 IEA:Ensembl P response to activity
GO:0009749 IEA:Ensembl P response to glucose
GO:0033189 IEA:Ensembl P response to vitamin A
GO:0006367 TAS:Reactome P transcription initiation from RNA polymerase II promoter
GO:0006776 IEA:Ensembl P vitamin A metabolic process
GO:0042060 IEA:Ensembl P wound healing

KEGG Pathway Links

KEGG Pathway ID Description
hsa05221 Acute myeloid leukemia

Domain Information

InterPro Annotations

Accession Description
IPR008946 Nuclear hormone receptor, ligand-binding
IPR000536 Nuclear hormone receptor, ligand-binding, core
IPR003074 Peroxisome proliferator-activated receptor
IPR003075 Peroxisome proliferator-activated receptor, beta
IPR001723 Steroid hormone receptor
IPR013088 Zinc finger, NHR/GATA-type
IPR001628 Zinc finger, nuclear hormone receptor-type

UniProt Annotations

Entry Information

Gene Name
peroxisome proliferator-activated receptor delta
Protein Entry
PPARD_HUMAN
UniProt ID
Q03181
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=Q03181-1; Sequence=Displayed; Name=2; IsoId=Q03181-2; Sequence=VSP_010133, VSP_010134; Name=3; IsoId=Q03181-3; Sequence=VSP_043787; Name=4; IsoId=Q03181-4; Sequence=VSP_046104; Note=No experimental confirmation available.;
Function Ligand-activated transcription factor. Receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Has a preference for poly-unsaturated fatty acids, such as gamma-linoleic acid and eicosapentanoic acid. Once activated by a ligand, the receptor binds to promoter elements of target genes. Regulates the peroxisomal beta-oxidation pathway of fatty acids. Functions as transcription activator for the acyl-CoA oxidase gene. Decreases expression of NPC1L1 once activated by a ligand.
Interaction O60341:KDM1A; NbExp=2; IntAct=EBI-6426768, EBI-710124;
Similarity Belongs to the nuclear hormone receptor family. NR1 subfamily.
Similarity Contains 1 nuclear receptor DNA-binding domain.
Subcellular Location Nucleus.
Subunit Heterodimer with the retinoid X receptor. {ECO
Tissue Specificity Ubiquitous with maximal levels in placenta and skeletal muscle.
Web Resource Name=Atlas of Genetics and Cytogenetics in Oncology and Haematology; URL="http://atlasgeneticsoncology.org/Genes/PPARDID41794ch6p21.html";
Web Resource Name=NIEHS-SNPs; URL="http://egp.gs.washington.edu/data/ppard/";
Web Resource Name=Wikipedia; Note=Peroxisome proliferator- activated receptor entry; URL="http://en.wikipedia.org/wiki/Peroxisome_proliferator-activated_receptor";

Identical and Related Proteins

Unique RefSeq proteins for LMP000426 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
284807155 RefSeq NP_001165289 441 peroxisome proliferator-activated receptor delta isoform 1
29171750 RefSeq NP_803184 361 peroxisome proliferator-activated receptor delta isoform 2
284807157 RefSeq NP_001165290 402 peroxisome proliferator-activated receptor delta isoform 3
284807157 RefSeq NP_001165291 402 peroxisome proliferator-activated receptor delta isoform 4

Identical Sequences to LMP000426 proteins

Reference Database Accession Length Protein Name
GI:284807157 DBBJ BAH12347.1 402 unnamed protein product [Homo sapiens]
GI:284807157 DBBJ BAH12347.1 402 unnamed protein product [Homo sapiens]
GI:29171750 GenBank AAH02715.1 361 PPARD protein [Homo sapiens]
GI:29171750 GenBank AAH07578.1 361 PPARD protein [Homo sapiens]
GI:29171750 GenBank EAX03826.1 361 peroxisome proliferative activated receptor, delta, isoform CRA_b [Homo sapiens]
GI:29171750 GenBank ADZ17376.1 361 peroxisome proliferator-activated nuclear receptor beta/delta variant 2 [Homo sapiens]
GI:29171750 GenBank JAA06097.1 361 peroxisome proliferator-activated receptor delta [Pan troglodytes]
GI:284807155 GenBank AHE19864.1 441 Sequence 40 from patent US 8574635
GI:29171750 GenBank AIC54929.1 361 PPARD, partial [synthetic construct]
GI:284807155 RefSeq XP_005249250.1 441 PREDICTED: peroxisome proliferator-activated receptor delta isoform X3 [Homo sapiens]
GI:284807155 RefSeq XP_006715183.1 441 PREDICTED: peroxisome proliferator-activated receptor delta isoform X5 [Homo sapiens]
GI:284807155 RefSeq XP_006715184.1 441 PREDICTED: peroxisome proliferator-activated receptor delta isoform X6 [Homo sapiens]
GI:284807155 RefSeq XP_006715185.1 441 PREDICTED: peroxisome proliferator-activated receptor delta isoform X7 [Homo sapiens]
GI:284807155 RefSeq XP_006715186.1 441 PREDICTED: peroxisome proliferator-activated receptor delta isoform X8 [Homo sapiens]

Related Sequences to LMP000426 proteins

Reference Database Accession Length Protein Name
GI:29171750 GenBank AAP36130.1 362 Homo sapiens peroxisome proliferative activated receptor, delta, partial [synthetic construct]
GI:29171750 GenBank AAX29360.1 362 peroxisome proliferative activated receptor delta, partial [synthetic construct]
GI:29171750 GenBank AAX29361.1 362 peroxisome proliferative activated receptor delta, partial [synthetic construct]
GI:284807157 GenBank ACM86099.1 500 Sequence 11597 from patent US 6812339
GI:284807155 GenBank ACM86099.1 500 Sequence 11597 from patent US 6812339
GI:284807157 GenBank ACM86099.1 500 Sequence 11597 from patent US 6812339
GI:29171750 GenBank AFH29701.1 361 peroxisome proliferator-activated receptor delta isoform 2 [Macaca mulatta]
GI:29171750 GenBank AFI33298.1 361 peroxisome proliferator-activated receptor delta isoform 2 [Macaca mulatta]
GI:284807155 RefSeq XP_518905.2 441 PREDICTED: peroxisome proliferator-activated receptor delta isoform X1 [Pan troglodytes]
GI:284807157 RefSeq XP_003789173.1 402 PREDICTED: peroxisome proliferator-activated receptor delta isoform 2 [Otolemur garnettii]
GI:284807157 RefSeq XP_003789173.1 402 PREDICTED: peroxisome proliferator-activated receptor delta isoform 2 [Otolemur garnettii]
GI:284807157 RefSeq XP_004424286.1 402 PREDICTED: peroxisome proliferator-activated receptor delta isoform 2 [Ceratotherium simum simum]
GI:284807157 RefSeq XP_004424286.1 402 PREDICTED: peroxisome proliferator-activated receptor delta isoform 2 [Ceratotherium simum simum]
GI:284807155 RefSeq XP_009449383.1 441 PREDICTED: peroxisome proliferator-activated receptor delta isoform X1 [Pan troglodytes]
GI:284807155 RefSeq XP_009449384.1 441 PREDICTED: peroxisome proliferator-activated receptor delta isoform X1 [Pan troglodytes]
GI:284807155 RefSeq XP_009449385.1 441 PREDICTED: peroxisome proliferator-activated receptor delta isoform X1 [Pan troglodytes]
GI:284807155 RefSeq XP_009449386.1 441 PREDICTED: peroxisome proliferator-activated receptor delta isoform X1 [Pan troglodytes]
GI:29171750 RefSeq XP_009449387.1 380 PREDICTED: peroxisome proliferator-activated receptor delta isoform X2 [Pan troglodytes]
GI:284807157 RefSeq XP_010387950.1 441 PREDICTED: peroxisome proliferator-activated receptor delta isoform X1 [Rhinopithecus roxellana]
GI:284807157 RefSeq XP_010387950.1 441 PREDICTED: peroxisome proliferator-activated receptor delta isoform X1 [Rhinopithecus roxellana]
GI:284807157 RefSeq XP_010387951.1 441 PREDICTED: peroxisome proliferator-activated receptor delta isoform X1 [Rhinopithecus roxellana]
GI:284807157 RefSeq XP_010387951.1 441 PREDICTED: peroxisome proliferator-activated receptor delta isoform X1 [Rhinopithecus roxellana]
GI:284807157 RefSeq XP_010387952.1 441 PREDICTED: peroxisome proliferator-activated receptor delta isoform X1 [Rhinopithecus roxellana]
GI:284807157 RefSeq XP_010387952.1 441 PREDICTED: peroxisome proliferator-activated receptor delta isoform X1 [Rhinopithecus roxellana]