Gene/Proteome Database (LMPD)
Proteins
cardiolipin synthase isoform 1 | |
---|---|
Refseq ID | NP_001019556 |
Protein GI | 66932980 |
UniProt ID | Q80ZM8 |
mRNA ID | NM_001024385 |
Length | 303 |
RefSeq Status | VALIDATED |
MLAWRVARGAWGPLRVALRPPGARLGRGGSRRALLPPAACCLGCLAERWRLRPAAFALRLPGAGPRTHCSGAGKAAPEPAAGGGGAAAQAPSARWVPASAASSYENPWTIPNLLSMTRIGLAPVLGYLILEEDFNVALGVFALAGLTDLLDGFIARNWANQKSALGSALDPLADKVLISILYISLTYADLIPVPLTYMIISRDVMLIAAVFYVRYRTLPTPRTLAKYFNPCYATARLKPTFISKVNTAVQLILVAASLAAPVFNYADSIYLQILWCCTAFTTAASAYSYYHYGRKTVQVIKGK |
cardiolipin synthase isoform 2 | |
---|---|
Refseq ID | NP_079922 |
Protein GI | 27754128 |
UniProt ID | Q80ZM8 |
mRNA ID | NM_025646 |
Length | 188 |
RefSeq Status | VALIDATED |
MTRIGLAPVLGYLILEEDFNVALGVFALAGLTDLLDGFIARNWANQKSALGSALDPLADKVLISILYISLTYADLIPVPLTYMIISRDVMLIAAVFYVRYRTLPTPRTLAKYFNPCYATARLKPTFISKVNTAVQLILVAASLAAPVFNYADSIYLQILWCCTAFTTAASAYSYYHYGRKTVQVIKGK |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005743 | IEA:UniProtKB-KW | C | mitochondrial inner membrane |
GO:0005739 | IDA:MGI | C | mitochondrion |
GO:0016780 | IEA:InterPro | F | phosphotransferase activity, for other substituted phosphate groups |
GO:0008654 | IEA:UniProtKB-KW | P | phospholipid biosynthetic process |
KEGG Pathway Links
REACTOME Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR000462 | CDP-alcohol phosphatidyltransferase |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | 2 Phosphatidylglycerol = diphosphatidylglycerol + glycerol. |
Function | Catalyzes the reversible phosphatidyl group transfer from one phosphatidylglycerol molecule to another to form cardiolipin (CL) (diphosphatidylglycerol) and glycerol. |
Sequence Caution | Sequence=BAB30134.1; Type=Erroneous initiation; Evidence={ECO:0000305}; |
Similarity | Belongs to the CDP-alcohol phosphatidyltransferase class-I family. {ECO:0000305}. |
Subcellular Location | Mitochondrion inner membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000433 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
66932980 | RefSeq | NP_001019556 | 303 | cardiolipin synthase isoform 1 |
27754128 | RefSeq | NP_079922 | 188 | cardiolipin synthase isoform 2 |
Identical Sequences to LMP000433 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:27754128 | DBBJ | BAB30134.1 | 188 | unnamed protein product [Mus musculus] |
GI:66932980 | GenBank | AAH48702.1 | 303 | Cardiolipin synthase 1 [Mus musculus] |
GI:66932980 | GenBank | EDL28365.1 | 303 | mCG19481, isoform CRA_c [Mus musculus] |
GI:27754128 | RefSeq | XP_006235141.1 | 188 | PREDICTED: cardiolipin synthase isoform X2 [Rattus norvegicus] |
GI:27754128 | RefSeq | XP_006235142.1 | 188 | PREDICTED: cardiolipin synthase isoform X2 [Rattus norvegicus] |
GI:66932980 | SwissProt | Q80ZM8.1 | 303 | RecName: Full=Cardiolipin synthase; Short=CLS [Mus musculus] |
Related Sequences to LMP000433 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:27754128 | GenBank | AAH48702.1 | 303 | Cardiolipin synthase 1 [Mus musculus] |
GI:66932980 | GenBank | AAH85849.1 | 302 | Cardiolipin synthase 1 [Rattus norvegicus] |
GI:27754128 | GenBank | EDL28365.1 | 303 | mCG19481, isoform CRA_c [Mus musculus] |
GI:66932980 | GenBank | EDL80276.1 | 302 | similar to chromosome 20 open reading frame 155 [Rattus norvegicus] |
GI:27754128 | GenBank | EDL80276.1 | 302 | similar to chromosome 20 open reading frame 155 [Rattus norvegicus] |
GI:66932980 | GenBank | AFI34374.1 | 301 | cardiolipin synthase isoform 1 [Macaca mulatta] |
GI:66932980 | RefSeq | NP_001014280.1 | 302 | cardiolipin synthase [Rattus norvegicus] |
GI:27754128 | RefSeq | NP_001019556.1 | 303 | cardiolipin synthase isoform 1 [Mus musculus] |
GI:66932980 | RefSeq | XP_008821057.1 | 300 | PREDICTED: cardiolipin synthase [Nannospalax galili] |
GI:27754128 | SwissProt | Q80ZM8.1 | 303 | RecName: Full=Cardiolipin synthase; Short=CLS [Mus musculus] |
GI:66932980 | SwissProt | Q5U2V5.1 | 302 | RecName: Full=Cardiolipin synthase; Short=CLS [Rattus norvegicus] |
GI:27754128 | SwissProt | Q5U2V5.1 | 302 | RecName: Full=Cardiolipin synthase; Short=CLS [Rattus norvegicus] |