Gene/Proteome Database (LMPD)
Proteins
| cardiolipin synthase isoform 1 | |
|---|---|
| Refseq ID | NP_001019556 |
| Protein GI | 66932980 |
| UniProt ID | Q80ZM8 |
| mRNA ID | NM_001024385 |
| Length | 303 |
| RefSeq Status | VALIDATED |
| MLAWRVARGAWGPLRVALRPPGARLGRGGSRRALLPPAACCLGCLAERWRLRPAAFALRLPGAGPRTHCSGAGKAAPEPAAGGGGAAAQAPSARWVPASAASSYENPWTIPNLLSMTRIGLAPVLGYLILEEDFNVALGVFALAGLTDLLDGFIARNWANQKSALGSALDPLADKVLISILYISLTYADLIPVPLTYMIISRDVMLIAAVFYVRYRTLPTPRTLAKYFNPCYATARLKPTFISKVNTAVQLILVAASLAAPVFNYADSIYLQILWCCTAFTTAASAYSYYHYGRKTVQVIKGK | |
| cardiolipin synthase isoform 2 | |
|---|---|
| Refseq ID | NP_079922 |
| Protein GI | 27754128 |
| UniProt ID | Q80ZM8 |
| mRNA ID | NM_025646 |
| Length | 188 |
| RefSeq Status | VALIDATED |
| MTRIGLAPVLGYLILEEDFNVALGVFALAGLTDLLDGFIARNWANQKSALGSALDPLADKVLISILYISLTYADLIPVPLTYMIISRDVMLIAAVFYVRYRTLPTPRTLAKYFNPCYATARLKPTFISKVNTAVQLILVAASLAAPVFNYADSIYLQILWCCTAFTTAASAYSYYHYGRKTVQVIKGK | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005743 | IEA:UniProtKB-KW | C | mitochondrial inner membrane |
| GO:0005739 | IDA:MGI | C | mitochondrion |
| GO:0016780 | IEA:InterPro | F | phosphotransferase activity, for other substituted phosphate groups |
| GO:0008654 | IEA:UniProtKB-KW | P | phospholipid biosynthetic process |
KEGG Pathway Links
REACTOME Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR000462 | CDP-alcohol phosphatidyltransferase |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 2 Phosphatidylglycerol = diphosphatidylglycerol + glycerol. |
| Function | Catalyzes the reversible phosphatidyl group transfer from one phosphatidylglycerol molecule to another to form cardiolipin (CL) (diphosphatidylglycerol) and glycerol. |
| Sequence Caution | Sequence=BAB30134.1; Type=Erroneous initiation; Evidence={ECO:0000305}; |
| Similarity | Belongs to the CDP-alcohol phosphatidyltransferase class-I family. {ECO:0000305}. |
| Subcellular Location | Mitochondrion inner membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000433 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 66932980 | RefSeq | NP_001019556 | 303 | cardiolipin synthase isoform 1 |
| 27754128 | RefSeq | NP_079922 | 188 | cardiolipin synthase isoform 2 |
Identical Sequences to LMP000433 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:27754128 | DBBJ | BAB30134.1 | 188 | unnamed protein product [Mus musculus] |
| GI:66932980 | GenBank | AAH48702.1 | 303 | Cardiolipin synthase 1 [Mus musculus] |
| GI:66932980 | GenBank | EDL28365.1 | 303 | mCG19481, isoform CRA_c [Mus musculus] |
| GI:27754128 | RefSeq | XP_006235141.1 | 188 | PREDICTED: cardiolipin synthase isoform X2 [Rattus norvegicus] |
| GI:27754128 | RefSeq | XP_006235142.1 | 188 | PREDICTED: cardiolipin synthase isoform X2 [Rattus norvegicus] |
| GI:66932980 | SwissProt | Q80ZM8.1 | 303 | RecName: Full=Cardiolipin synthase; Short=CLS [Mus musculus] |
Related Sequences to LMP000433 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:27754128 | GenBank | AAH48702.1 | 303 | Cardiolipin synthase 1 [Mus musculus] |
| GI:66932980 | GenBank | AAH85849.1 | 302 | Cardiolipin synthase 1 [Rattus norvegicus] |
| GI:27754128 | GenBank | EDL28365.1 | 303 | mCG19481, isoform CRA_c [Mus musculus] |
| GI:27754128 | GenBank | EDL80276.1 | 302 | similar to chromosome 20 open reading frame 155 [Rattus norvegicus] |
| GI:66932980 | GenBank | EDL80276.1 | 302 | similar to chromosome 20 open reading frame 155 [Rattus norvegicus] |
| GI:66932980 | GenBank | AFI34374.1 | 301 | cardiolipin synthase isoform 1 [Macaca mulatta] |
| GI:66932980 | RefSeq | NP_001014280.1 | 302 | cardiolipin synthase [Rattus norvegicus] |
| GI:27754128 | RefSeq | NP_001019556.1 | 303 | cardiolipin synthase isoform 1 [Mus musculus] |
| GI:66932980 | RefSeq | XP_008821057.1 | 300 | PREDICTED: cardiolipin synthase [Nannospalax galili] |
| GI:27754128 | SwissProt | Q80ZM8.1 | 303 | RecName: Full=Cardiolipin synthase; Short=CLS [Mus musculus] |
| GI:66932980 | SwissProt | Q5U2V5.1 | 302 | RecName: Full=Cardiolipin synthase; Short=CLS [Rattus norvegicus] |
| GI:27754128 | SwissProt | Q5U2V5.1 | 302 | RecName: Full=Cardiolipin synthase; Short=CLS [Rattus norvegicus] |