Gene/Proteome Database (LMPD)

LMPD ID
LMP000433
Gene ID
Species
Mus musculus (Mouse)
Gene Name
cardiolipin synthase 1
Gene Symbol
Synonyms
0610009I22Rik; 4930557M15Rik; 5730490M08Rik
Alternate Names
cardiolipin synthase; CLS
Chromosome
2
Map Location
2|2 F3
EC Number
2.7.8.-

Proteins

cardiolipin synthase isoform 1
Refseq ID NP_001019556
Protein GI 66932980
UniProt ID Q80ZM8
mRNA ID NM_001024385
Length 303
RefSeq Status VALIDATED
MLAWRVARGAWGPLRVALRPPGARLGRGGSRRALLPPAACCLGCLAERWRLRPAAFALRLPGAGPRTHCSGAGKAAPEPAAGGGGAAAQAPSARWVPASAASSYENPWTIPNLLSMTRIGLAPVLGYLILEEDFNVALGVFALAGLTDLLDGFIARNWANQKSALGSALDPLADKVLISILYISLTYADLIPVPLTYMIISRDVMLIAAVFYVRYRTLPTPRTLAKYFNPCYATARLKPTFISKVNTAVQLILVAASLAAPVFNYADSIYLQILWCCTAFTTAASAYSYYHYGRKTVQVIKGK
cardiolipin synthase isoform 2
Refseq ID NP_079922
Protein GI 27754128
UniProt ID Q80ZM8
mRNA ID NM_025646
Length 188
RefSeq Status VALIDATED
MTRIGLAPVLGYLILEEDFNVALGVFALAGLTDLLDGFIARNWANQKSALGSALDPLADKVLISILYISLTYADLIPVPLTYMIISRDVMLIAAVFYVRYRTLPTPRTLAKYFNPCYATARLKPTFISKVNTAVQLILVAASLAAPVFNYADSIYLQILWCCTAFTTAASAYSYYHYGRKTVQVIKGK

Gene Information

Entrez Gene ID
Gene Name
cardiolipin synthase 1
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005743 IEA:UniProtKB-KW C mitochondrial inner membrane
GO:0005739 IDA:MGI C mitochondrion
GO:0016780 IEA:InterPro F phosphotransferase activity, for other substituted phosphate groups
GO:0008654 IEA:UniProtKB-KW P phospholipid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
mmu00564 Glycerophospholipid metabolism
mmu01100 Metabolic pathways

REACTOME Pathway Links

REACTOME Pathway ID Description
5893975 Acyl chain remodelling of PG
5892983 Glycerophospholipid biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR000462 CDP-alcohol phosphatidyltransferase

UniProt Annotations

Entry Information

Gene Name
cardiolipin synthase 1
Protein Entry
CRLS1_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Catalytic Activity 2 Phosphatidylglycerol = diphosphatidylglycerol + glycerol.
Function Catalyzes the reversible phosphatidyl group transfer from one phosphatidylglycerol molecule to another to form cardiolipin (CL) (diphosphatidylglycerol) and glycerol.
Sequence Caution Sequence=BAB30134.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Similarity Belongs to the CDP-alcohol phosphatidyltransferase class-I family. {ECO:0000305}.
Subcellular Location Mitochondrion inner membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP000433 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
66932980 RefSeq NP_001019556 303 cardiolipin synthase isoform 1
27754128 RefSeq NP_079922 188 cardiolipin synthase isoform 2

Identical Sequences to LMP000433 proteins

Reference Database Accession Length Protein Name
GI:27754128 DBBJ BAB30134.1 188 unnamed protein product [Mus musculus]
GI:66932980 GenBank AAH48702.1 303 Cardiolipin synthase 1 [Mus musculus]
GI:66932980 GenBank EDL28365.1 303 mCG19481, isoform CRA_c [Mus musculus]
GI:27754128 RefSeq XP_006235141.1 188 PREDICTED: cardiolipin synthase isoform X2 [Rattus norvegicus]
GI:27754128 RefSeq XP_006235142.1 188 PREDICTED: cardiolipin synthase isoform X2 [Rattus norvegicus]
GI:66932980 SwissProt Q80ZM8.1 303 RecName: Full=Cardiolipin synthase; Short=CLS [Mus musculus]

Related Sequences to LMP000433 proteins

Reference Database Accession Length Protein Name
GI:27754128 GenBank AAH48702.1 303 Cardiolipin synthase 1 [Mus musculus]
GI:66932980 GenBank AAH85849.1 302 Cardiolipin synthase 1 [Rattus norvegicus]
GI:27754128 GenBank EDL28365.1 303 mCG19481, isoform CRA_c [Mus musculus]
GI:66932980 GenBank EDL80276.1 302 similar to chromosome 20 open reading frame 155 [Rattus norvegicus]
GI:27754128 GenBank EDL80276.1 302 similar to chromosome 20 open reading frame 155 [Rattus norvegicus]
GI:66932980 GenBank AFI34374.1 301 cardiolipin synthase isoform 1 [Macaca mulatta]
GI:66932980 RefSeq NP_001014280.1 302 cardiolipin synthase [Rattus norvegicus]
GI:27754128 RefSeq NP_001019556.1 303 cardiolipin synthase isoform 1 [Mus musculus]
GI:66932980 RefSeq XP_008821057.1 300 PREDICTED: cardiolipin synthase [Nannospalax galili]
GI:27754128 SwissProt Q80ZM8.1 303 RecName: Full=Cardiolipin synthase; Short=CLS [Mus musculus]
GI:66932980 SwissProt Q5U2V5.1 302 RecName: Full=Cardiolipin synthase; Short=CLS [Rattus norvegicus]
GI:27754128 SwissProt Q5U2V5.1 302 RecName: Full=Cardiolipin synthase; Short=CLS [Rattus norvegicus]