Gene/Proteome Database (LMPD)

LMPD ID
LMP000453
Gene ID
1571
Species
Homo sapiens (Human)
Gene Name
cytochrome P450, family 2, subfamily E, polypeptide 1
Gene Symbol
CYP2E1
Synonyms
CPE1; CYP2E; P450-J; P450C2E
Alternate Names
cytochrome P450 2E1; CYPIIE1; cytochrome P450-J; microsomal monooxygenase; xenobiotic monooxygenase; 4-nitrophenol 2-hydroxylase; flavoprotein-linked monooxygenase; cytochrome P450, subfamily IIE (ethanol-inducible), polypeptide 1
Chromosome
10
Map Location
10q26.3
EC Number
1.14.13.-
Summary
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation. The enzyme metabolizes both endogenous substrates, such as ethanol, acetone, and acetal, as well as exogenous substrates including benzene, carbon tetrachloride, ethylene glycol, and nitrosamines which are premutagens found in cigarette smoke. Due to its many substrates, this enzyme may be involved in such varied processes as gluconeogenesis, hepatic cirrhosis, diabetes, and cancer. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for CYP2E1

Proteins

cytochrome P450 2E1 precursor
Refseq ID NP_000764
Protein GI 10834998
UniProt ID P05181
mRNA ID NM_000773
Length 493
RefSeq Status REVIEWED
MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRLAQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGPTWKDIRRFSLTTLRNYGMGKQGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVIADILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVAEVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAGTETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGCIPPRYKLCVIPRS
sig_peptide: 1..28 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 3100 peptide sequence: MSALGVTVALLVWAAFLLLVSMWRQVHS

Gene Information

Entrez Gene ID
1571
Gene Name
cytochrome P450, family 2, subfamily E, polypeptide 1
Gene Symbol
CYP2E1
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0000139 IEA:Ensembl C Golgi membrane
GO:0005789 TAS:Reactome C endoplasmic reticulum membrane
GO:0031227 IEA:Ensembl C intrinsic component of endoplasmic reticulum membrane
GO:0005739 IEA:Ensembl C mitochondrion
GO:0019899 IPI:BHF-UCL F enzyme binding
GO:0020037 IDA:UniProtKB F heme binding
GO:0005506 IEA:InterPro F iron ion binding
GO:0004497 IDA:BHF-UCL F monooxygenase activity
GO:0016491 IDA:BHF-UCL F oxidoreductase activity
GO:0016709 TAS:UniProtKB F oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
GO:0016712 IEA:Ensembl F oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
GO:0019825 TAS:ProtInc F oxygen binding
GO:0017144 IDA:BHF-UCL P drug metabolic process
GO:0046483 IDA:BHF-UCL P heterocycle metabolic process
GO:0016098 IDA:BHF-UCL P monoterpenoid metabolic process
GO:0055114 IDA:BHF-UCL P oxidation-reduction process
GO:0042493 IEA:Ensembl P response to drug
GO:0045471 IEA:Ensembl P response to ethanol
GO:0010243 IEA:Ensembl P response to organonitrogen compound
GO:0010193 IEA:Ensembl P response to ozone
GO:0044281 TAS:Reactome P small molecule metabolic process
GO:0008202 IMP:BHF-UCL P steroid metabolic process
GO:0006641 IEA:Ensembl P triglyceride metabolic process
GO:0006805 TAS:Reactome P xenobiotic metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa05204 Chemical carcinogenesis
hsa04932 Non-alcoholic fatty liver disease (NAFLD)

Domain Information

InterPro Annotations

Accession Description
IPR001128 Cytochrome P450
IPR002401 Cytochrome P450, E-class, group I
IPR008070 Cytochrome P450, E-class, group I, CYP2E-like
IPR017972 Cytochrome P450, conserved site

UniProt Annotations

Entry Information

Gene Name
cytochrome P450, family 2, subfamily E, polypeptide 1
Protein Entry
CP2E1_HUMAN
UniProt ID
P05181
Species
Human

Comments

Comment Type Description
Catalytic Activity 4-nitrophenol + NADPH + O(2) = 4-nitrocatechol + NADP(+) + H(2)O.
Cofactor Name=heme; Xref=ChEBI
Function Metabolizes several precarcinogens, drugs, and solvents to reactive metabolites. Inactivates a number of drugs and xenobiotics and also bioactivates many xenobiotic substrates to their hepatotoxic or carcinogenic forms.
Induction By ethanol and isoniazid.
Similarity Belongs to the cytochrome P450 family.
Subcellular Location Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein.
Web Resource Name=Cytochrome P450 Allele Nomenclature Committee; Note=CYP2E1 alleles; URL="http://www.cypalleles.ki.se/cyp2e1.htm";
Web Resource Name=NIEHS-SNPs; URL="http://egp.gs.washington.edu/data/cyp2e1/";
Web Resource Name=Wikipedia; Note=CYP2E1 entry; URL="http://en.wikipedia.org/wiki/CYP2E1";

Identical and Related Proteins

Unique RefSeq proteins for LMP000453 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
10834998 RefSeq NP_000764 493 cytochrome P450 2E1 precursor

Identical Sequences to LMP000453 proteins

Reference Database Accession Length Protein Name
GI:10834998 EMBL CBJ21225.1 493 unnamed protein product [Homo sapiens]
GI:10834998 GenBank AED82147.1 493 Sequence 884 from patent US 7919467
GI:10834998 GenBank AEP61336.1 493 Sequence 18 from patent US 8026085
GI:10834998 GenBank AFL28704.1 493 Sequence 264 from patent US 8168602
GI:10834998 GenBank AFQ85869.1 493 Sequence 18 from patent US 8252559
GI:10834998 GenBank AHD70779.1 493 Sequence 4247 from patent US 8586006

Related Sequences to LMP000453 proteins

Reference Database Accession Length Protein Name
GI:10834998 DBBJ BAF83511.1 493 unnamed protein product [Homo sapiens]
GI:10834998 GenBank AAF13601.1 493 cytochrome P450-2E1 [Homo sapiens]
GI:10834998 GenBank AAH67435.1 493 Cytochrome P450, family 2, subfamily E, polypeptide 1 [Homo sapiens]
GI:10834998 GenBank AAZ77710.1 493 cytochrome P450 2E1, partial [Homo sapiens]
GI:10834998 GenBank AIC54256.1 493 CYP2E1, partial [synthetic construct]
GI:10834998 RefSeq XP_008970672.1 493 PREDICTED: cytochrome P450 2E1 [Pan paniscus]