Gene/Proteome Database (LMPD)
LMPD ID
LMP000453
Gene ID
Species
Homo sapiens (Human)
Gene Name
cytochrome P450, family 2, subfamily E, polypeptide 1
Gene Symbol
Synonyms
CPE1; CYP2E; P450-J; P450C2E
Alternate Names
cytochrome P450 2E1; CYPIIE1; cytochrome P450-J; microsomal monooxygenase; xenobiotic monooxygenase; 4-nitrophenol 2-hydroxylase; flavoprotein-linked monooxygenase; cytochrome P450, subfamily IIE (ethanol-inducible), polypeptide 1
Chromosome
10
Map Location
10q26.3
EC Number
1.14.13.-
Summary
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation. The enzyme metabolizes both endogenous substrates, such as ethanol, acetone, and acetal, as well as exogenous substrates including benzene, carbon tetrachloride, ethylene glycol, and nitrosamines which are premutagens found in cigarette smoke. Due to its many substrates, this enzyme may be involved in such varied processes as gluconeogenesis, hepatic cirrhosis, diabetes, and cancer. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| cytochrome P450 2E1 precursor | |
|---|---|
| Refseq ID | NP_000764 |
| Protein GI | 10834998 |
| UniProt ID | P05181 |
| mRNA ID | NM_000773 |
| Length | 493 |
| RefSeq Status | REVIEWED |
| MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRLAQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGPTWKDIRRFSLTTLRNYGMGKQGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVIADILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVAEVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAGTETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGCIPPRYKLCVIPRS | |
| sig_peptide: 1..28 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 3100 peptide sequence: MSALGVTVALLVWAAFLLLVSMWRQVHS | |
Gene Information
Entrez Gene ID
Gene Name
cytochrome P450, family 2, subfamily E, polypeptide 1
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0000139 | IEA:Ensembl | C | Golgi membrane |
| GO:0005789 | TAS:Reactome | C | endoplasmic reticulum membrane |
| GO:0031227 | IEA:Ensembl | C | intrinsic component of endoplasmic reticulum membrane |
| GO:0005739 | IEA:Ensembl | C | mitochondrion |
| GO:0019899 | IPI:BHF-UCL | F | enzyme binding |
| GO:0020037 | IDA:UniProtKB | F | heme binding |
| GO:0005506 | IEA:InterPro | F | iron ion binding |
| GO:0004497 | IDA:BHF-UCL | F | monooxygenase activity |
| GO:0016491 | IDA:BHF-UCL | F | oxidoreductase activity |
| GO:0016709 | TAS:UniProtKB | F | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen |
| GO:0016712 | IEA:Ensembl | F | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen |
| GO:0019825 | TAS:ProtInc | F | oxygen binding |
| GO:0017144 | IDA:BHF-UCL | P | drug metabolic process |
| GO:0046483 | IDA:BHF-UCL | P | heterocycle metabolic process |
| GO:0016098 | IDA:BHF-UCL | P | monoterpenoid metabolic process |
| GO:0055114 | IDA:BHF-UCL | P | oxidation-reduction process |
| GO:0042493 | IEA:Ensembl | P | response to drug |
| GO:0045471 | IEA:Ensembl | P | response to ethanol |
| GO:0010243 | IEA:Ensembl | P | response to organonitrogen compound |
| GO:0010193 | IEA:Ensembl | P | response to ozone |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0008202 | IMP:BHF-UCL | P | steroid metabolic process |
| GO:0006641 | IEA:Ensembl | P | triglyceride metabolic process |
| GO:0006805 | TAS:Reactome | P | xenobiotic metabolic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
cytochrome P450, family 2, subfamily E, polypeptide 1
Protein Entry
CP2E1_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 4-nitrophenol + NADPH + O(2) = 4-nitrocatechol + NADP(+) + H(2)O. |
| Cofactor | Name=heme; Xref=ChEBI |
| Function | Metabolizes several precarcinogens, drugs, and solvents to reactive metabolites. Inactivates a number of drugs and xenobiotics and also bioactivates many xenobiotic substrates to their hepatotoxic or carcinogenic forms. |
| Induction | By ethanol and isoniazid. |
| Similarity | Belongs to the cytochrome P450 family. |
| Subcellular Location | Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein. |
| Web Resource | Name=Cytochrome P450 Allele Nomenclature Committee; Note=CYP2E1 alleles; URL="http://www.cypalleles.ki.se/cyp2e1.htm"; |
| Web Resource | Name=NIEHS-SNPs; URL="http://egp.gs.washington.edu/data/cyp2e1/"; |
| Web Resource | Name=Wikipedia; Note=CYP2E1 entry; URL="http://en.wikipedia.org/wiki/CYP2E1"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP000453 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 10834998 | RefSeq | NP_000764 | 493 | cytochrome P450 2E1 precursor |
Identical Sequences to LMP000453 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:10834998 | EMBL | CBJ21225.1 | 493 | unnamed protein product [Homo sapiens] |
| GI:10834998 | GenBank | AED82147.1 | 493 | Sequence 884 from patent US 7919467 |
| GI:10834998 | GenBank | AEP61336.1 | 493 | Sequence 18 from patent US 8026085 |
| GI:10834998 | GenBank | AFL28704.1 | 493 | Sequence 264 from patent US 8168602 |
| GI:10834998 | GenBank | AFQ85869.1 | 493 | Sequence 18 from patent US 8252559 |
| GI:10834998 | GenBank | AHD70779.1 | 493 | Sequence 4247 from patent US 8586006 |
Related Sequences to LMP000453 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:10834998 | DBBJ | BAF83511.1 | 493 | unnamed protein product [Homo sapiens] |
| GI:10834998 | GenBank | AAF13601.1 | 493 | cytochrome P450-2E1 [Homo sapiens] |
| GI:10834998 | GenBank | AAH67435.1 | 493 | Cytochrome P450, family 2, subfamily E, polypeptide 1 [Homo sapiens] |
| GI:10834998 | GenBank | AAZ77710.1 | 493 | cytochrome P450 2E1, partial [Homo sapiens] |
| GI:10834998 | GenBank | AIC54256.1 | 493 | CYP2E1, partial [synthetic construct] |
| GI:10834998 | RefSeq | XP_008970672.1 | 493 | PREDICTED: cytochrome P450 2E1 [Pan paniscus] |