Gene/Proteome Database (LMPD)
Proteins
| phosphatidylserine decarboxylase proenzyme | |
|---|---|
| Refseq ID | NP_796272 |
| Protein GI | 126722757 |
| UniProt ID | Q505E1 |
| mRNA ID | NM_177298 |
| Length | 406 |
| RefSeq Status | VALIDATED |
| MAASGGRACVRSLRGGVLWRSSPCHYESTATRHFLGTLQKLPLQAGVRNFHTAPVRSLFLLRPVPILLATGGGYAGYRQYEKYRERKLEKLGLEIPPKLASHWEVSLYKSVPTRLLSRACGRLNQVELPYWLRRPVYSLYIWTFGVNMTEAAVEDLHHYRNLSEFFRRKLKPQARPVCGLHCVTSPSDGKILTFGQVKNSEVEQVKGVTYSLESFLGPRANTEDLPFPPASSSDSFRNQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTISHRRHFPGSLMSVNPGMARWIKELFCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIHFDRDLHTNSPRYSKGSYNDLSFVTHANKEGIPMRKGEPLGEFNLGSTIVLIFEAPKDFNFRLKAGQKIRFGEALGSL | |
| mat_peptide: 1..374 product: Phosphatidylserine decarboxylase beta chain experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q8BSF4.1) calculated_mol_wt: 42378 peptide sequence: MAASGGRACVRSLRGGVLWRSSPCHYESTATRHFLGTLQKLPLQAGVRNFHTAPVRSLFLLRPVPILLATGGGYAGYRQYEKYRERKLEKLGLEIPPKLASHWEVSLYKSVPTRLLSRACGRLNQVELPYWLRRPVYSLYIWTFGVNMTEAAVEDLHHYRNLSEFFRRKLKPQARPVCGLHCVTSPSDGKILTFGQVKNSEVEQVKGVTYSLESFLGPRANTEDLPFPPASSSDSFRNQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTISHRRHFPGSLMSVNPGMARWIKELFCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIHFDRDLHTNSPRYSKGSYNDLSFVTHANKEGIPMRKGEPLGEFNLG mat_peptide: 375..406 product: Phosphatidylserine decarboxylase alpha chain experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q8BSF4.1) calculated_mol_wt: 3567 peptide sequence: STIVLIFEAPKDFNFRLKAGQKIRFGEALGSL | |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylserine decarboxylase
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005739 | IDA:MGI | C | mitochondrion |
| GO:0004609 | IEA:InterPro | F | phosphatidylserine decarboxylase activity |
| GO:0008654 | IEA:InterPro | P | phospholipid biosynthetic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR003817 | Phosphatidylserine decarboxylase-related |
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP000463 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 126722757 | RefSeq | NP_796272 | 406 | phosphatidylserine decarboxylase proenzyme |
Identical Sequences to LMP000463 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:126722757 | DBBJ | BAE36689.1 | 406 | unnamed protein product [Mus musculus] |
| GI:126722757 | GenBank | AAH70408.1 | 406 | Phosphatidylserine decarboxylase [Mus musculus] |
| GI:126722757 | GenBank | AAH94594.1 | 406 | Phosphatidylserine decarboxylase [Mus musculus] |
| GI:126722757 | GenBank | AAI16696.1 | 406 | Phosphatidylserine decarboxylase [Mus musculus] |
| GI:126722757 | GenBank | AAI17510.1 | 406 | Phosphatidylserine decarboxylase [Mus musculus] |
| GI:126722757 | GenBank | EDL37403.1 | 406 | mCG2531, isoform CRA_g [Mus musculus] |
Related Sequences to LMP000463 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:126722757 | DBBJ | BAC28786.1 | 406 | unnamed protein product [Mus musculus] |
| GI:126722757 | DBBJ | BAE37044.1 | 406 | unnamed protein product [Mus musculus] |
| GI:126722757 | GenBank | EDM00144.1 | 409 | rCG36021, isoform CRA_f [Rattus norvegicus] |
| GI:126722757 | RefSeq | XP_002725046.1 | 409 | PREDICTED: phosphatidylserine decarboxylase proenzyme isoform X1 [Rattus norvegicus] |
| GI:126722757 | RefSeq | XP_001061408.2 | 409 | PREDICTED: phosphatidylserine decarboxylase proenzyme isoform X1 [Rattus norvegicus] |
| GI:126722757 | SwissProt | P27465.2 | 409 | RecName: Full=Phosphatidylserine decarboxylase proenzyme; Contains: RecName: Full=Phosphatidylserine decarboxylase alpha chain; Contains: RecName: Full=Phosphatidylserine decarboxylase beta chain [Cricetulus griseus] |