Gene/Proteome Database (LMPD)
LMPD ID
LMP000472
Gene ID
Species
Homo sapiens (Human)
Gene Name
phosphatidylinositol transfer protein, beta
Gene Symbol
Synonyms
PI-TP-beta; PtdInsTP; VIB1B
Alternate Names
phosphatidylinositol transfer protein beta isoform; PtdIns transfer protein beta; phosphotidylinositol transfer protein, beta
Chromosome
22
Map Location
22q12.1
Summary
This gene encodes a cytoplasmic protein that catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes. This transfer activity is required for COPI complex-mediated retrograde transport from the Golgi apparatus to the endoplasmic reticulum. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Sep 2013]
Orthologs
Proteins
phosphatidylinositol transfer protein beta isoform isoform 1 | |
---|---|
Refseq ID | NP_036531 |
Protein GI | 6912594 |
UniProt ID | P48739 |
mRNA ID | NM_012399 |
Length | 271 |
RefSeq Status | REVIEWED |
MVLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKRGSVRGTSAADV |
phosphatidylinositol transfer protein beta isoform isoform 2 | |
---|---|
Refseq ID | NP_001271206 |
Protein GI | 546232151 |
UniProt ID | P48739 |
mRNA ID | NM_001284277 |
Length | 272 |
RefSeq Status | REVIEWED |
MVLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETLRNQGQVRGTSAASDE |
phosphatidylinositol transfer protein beta isoform isoform 3 | |
---|---|
Refseq ID | NP_001271207 |
Protein GI | 546232153 |
UniProt ID | P48739 |
mRNA ID | NM_001284278 |
Length | 273 |
RefSeq Status | REVIEWED |
MGDLLMEKCRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKRGSVRGTSAADV |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylinositol transfer protein, beta
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0000139 | TAS:Reactome | C | Golgi membrane |
GO:0005789 | TAS:Reactome | C | endoplasmic reticulum membrane |
GO:0070062 | IDA:UniProt | C | extracellular vesicular exosome |
GO:0008289 | IEA:UniProtKB-KW | F | lipid binding |
GO:0046474 | TAS:Reactome | P | glycerophospholipid biosynthetic process |
GO:0001701 | IEA:Ensembl | P | in utero embryonic development |
GO:0006629 | NAS:ProtInc | P | lipid metabolic process |
GO:0006644 | TAS:Reactome | P | phospholipid metabolic process |
GO:0015914 | TAS:Reactome | P | phospholipid transport |
GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
REACT_121401 | Glycerophospholipid biosynthesis |
REACT_121175 | PI Metabolism |
REACT_121079 | PI and PC transport between ER and Golgi membranes |
REACT_120870 | Phospholipid metabolism |
Domain Information
UniProt Annotations
Entry Information
Gene Name
phosphatidylinositol transfer protein, beta
Protein Entry
PIPNB_HUMAN
UniProt ID
Species
Human
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P48739-1; Sequence=Displayed; Name=2; IsoId=P48739-2; Sequence=VSP_012762; Name=3; IsoId=P48739-3; Sequence=VSP_055132; |
Function | Catalyzes the transfer of PtdIns and phosphatidylcholine between membranes. |
Ptm | Constitutive phosphorylation of Ser-262 has no effect on phospholipid transfer activity but is required for Golgi targeting. |
Similarity | Belongs to the PtdIns transfer protein family. PI transfer class I subfamily. |
Subcellular Location | Cytoplasm . Golgi apparatus . |
Tissue Specificity | Widely expressed in various tissues including brain. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000472 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
6912594 | RefSeq | NP_036531 | 271 | phosphatidylinositol transfer protein beta isoform isoform 1 |
546232151 | RefSeq | NP_001271206 | 272 | phosphatidylinositol transfer protein beta isoform isoform 2 |
546232153 | RefSeq | NP_001271207 | 273 | phosphatidylinositol transfer protein beta isoform isoform 3 |
Identical Sequences to LMP000472 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:546232153 | DBBJ | BAH13686.1 | 273 | unnamed protein product [Homo sapiens] |
GI:546232153 | GenBank | EAW59743.1 | 273 | phosphatidylinositol transfer protein, beta, isoform CRA_a [Homo sapiens] |
GI:6912594 | GenBank | AIC51030.1 | 271 | PITPNB, partial [synthetic construct] |
GI:546232151 | GenBank | AIC59886.1 | 272 | PITPNB, partial [synthetic construct] |
GI:546232151 | RefSeq | XP_003820225.1 | 272 | PREDICTED: phosphatidylinositol transfer protein beta isoform isoform X1 [Pan paniscus] |
GI:546232151 | RefSeq | XP_003905411.1 | 272 | PREDICTED: phosphatidylinositol transfer protein beta isoform isoform X1 [Papio anubis] |
GI:6912594 | RefSeq | XP_004063264.1 | 271 | PREDICTED: phosphatidylinositol transfer protein beta isoform isoform 1 [Gorilla gorilla gorilla] |
GI:546232151 | RefSeq | XP_004063265.1 | 272 | PREDICTED: phosphatidylinositol transfer protein beta isoform isoform 2 [Gorilla gorilla gorilla] |
GI:546232153 | RefSeq | XP_004063266.1 | 273 | PREDICTED: phosphatidylinositol transfer protein beta isoform isoform 3 [Gorilla gorilla gorilla] |
GI:546232151 | RefSeq | XP_005567764.1 | 272 | PREDICTED: phosphatidylinositol transfer protein beta isoform isoform X1 [Macaca fascicularis] |
GI:6912594 | RefSeq | XP_005567766.1 | 271 | PREDICTED: phosphatidylinositol transfer protein beta isoform isoform X3 [Macaca fascicularis] |
GI:546232151 | RefSeq | XP_007973449.1 | 272 | PREDICTED: phosphatidylinositol transfer protein beta isoform isoform X1 [Chlorocebus sabaeus] |
GI:6912594 | RefSeq | XP_007973450.1 | 271 | PREDICTED: phosphatidylinositol transfer protein beta isoform isoform X2 [Chlorocebus sabaeus] |
GI:6912594 | RefSeq | XP_009232489.1 | 271 | PREDICTED: phosphatidylinositol transfer protein beta isoform isoform X1 [Pongo abelii] |
GI:6912594 | RefSeq | XP_010373875.1 | 271 | PREDICTED: phosphatidylinositol transfer protein beta isoform [Rhinopithecus roxellana] |
Related Sequences to LMP000472 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:546232153 | EMBL | CAK54572.1 | 271 | PITPNB [synthetic construct] |
GI:546232153 | EMBL | CAK54871.1 | 271 | PITPNB, partial [synthetic construct] |
GI:6912594 | GenBank | JAA44206.1 | 283 | phosphatidylinositol transfer protein, beta [Pan troglodytes] |
GI:6912594 | GenBank | JAA44207.1 | 283 | phosphatidylinositol transfer protein, beta [Pan troglodytes] |
GI:546232153 | RefSeq | XP_515049.1 | 271 | PREDICTED: phosphatidylinositol transfer protein beta isoform isoform X2 [Pan troglodytes] |
GI:6912594 | RefSeq | XP_001927816.1 | 271 | PREDICTED: phosphatidylinositol transfer protein beta isoform isoform X1 [Sus scrofa] |
GI:546232151 | RefSeq | XP_002926313.1 | 272 | PREDICTED: phosphatidylinositol transfer protein beta isoform-like [Ailuropoda melanoleuca] |
GI:546232153 | RefSeq | XP_003258078.1 | 271 | PREDICTED: phosphatidylinositol transfer protein beta isoform isoform 1 [Nomascus leucogenys] |
GI:546232153 | RefSeq | XP_003258080.1 | 273 | PREDICTED: phosphatidylinositol transfer protein beta isoform isoform 3 [Nomascus leucogenys] |
GI:6912594 | RefSeq | XP_003938529.1 | 271 | PREDICTED: phosphatidylinositol transfer protein beta isoform isoform X2 [Saimiri boliviensis boliviensis] |
GI:546232151 | RefSeq | XP_004816030.1 | 272 | PREDICTED: phosphatidylinositol transfer protein beta isoform isoform X1 [Mustela putorius furo] |
GI:546232151 | RefSeq | XP_005636443.1 | 272 | PREDICTED: phosphatidylinositol transfer protein beta isoform isoform X3 [Canis lupus familiaris] |
GI:546232151 | RefSeq | XP_005657393.1 | 272 | PREDICTED: phosphatidylinositol transfer protein beta isoform isoform X2 [Sus scrofa] |
GI:546232151 | RefSeq | XP_006067733.1 | 272 | PREDICTED: phosphatidylinositol transfer protein beta isoform isoform X1 [Bubalus bubalis] |
GI:6912594 | RefSeq | XP_006067734.1 | 271 | PREDICTED: phosphatidylinositol transfer protein beta isoform isoform X2 [Bubalus bubalis] |
GI:546232151 | RefSeq | XP_008568171.1 | 272 | PREDICTED: phosphatidylinositol transfer protein beta isoform isoform X1 [Galeopterus variegatus] |
GI:546232153 | SwissProt | P48739.2 | 271 | RecName: Full=Phosphatidylinositol transfer protein beta isoform; Short=PI-TP-beta; Short=PtdIns transfer protein beta; Short=PtdInsTP beta [Homo sapiens] |
GI:6912594 | SwissProt | Q9TR36.3 | 271 | RecName: Full=Phosphatidylinositol transfer protein beta isoform; Short=PI-TP-beta; Short=PtdIns transfer protein beta; Short=PtdInsTP beta; AltName: Full=Phosphatidylinositol-transfer protein 36 kDa isoform; Short=PI-TP 36 kda isoform [Bos taurus] |