Gene/Proteome Database (LMPD)
Proteins
| retinoic acid receptor beta isoform beta1 | |
|---|---|
| Refseq ID | NP_001276690 |
| Protein GI | 576795787 |
| UniProt ID | P22605 |
| mRNA ID | NM_001289761 |
| Length | 455 |
| RefSeq Status | VALIDATED |
| MSTSSHACPVPAVRGHMTHYPAAPYPLLFPPVIRGLSLPPLHGLHGHPPPSGCSTPSPATIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNIAEHSPSVSPSSVENSGVSQSPLLQ | |
| retinoic acid receptor beta isoform beta2 | |
|---|---|
| Refseq ID | NP_035373 |
| Protein GI | 45593124 |
| UniProt ID | P22605 |
| mRNA ID | NM_011243 |
| Length | 448 |
| RefSeq Status | VALIDATED |
| MFDCMDVLSVSPGQILDFYTASPSSCMLQEKALKACLSGFTQAEWQHRHTAQSIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNIAEHSPSVSPSSVENSGVSQSPLLQ | |
| retinoic acid receptor beta isoform beta3 | |
|---|---|
| Refseq ID | NP_001276689 |
| Protein GI | 576795732 |
| UniProt ID | P22605 |
| mRNA ID | NM_001289760 |
| Length | 482 |
| RefSeq Status | VALIDATED |
| MSTSSHACPVPAVRGHMTHYPAAPYPLLFPPVIRGLSLPPLHGLHGHPPPSGCSTPSPASVGQACQRTTGGSQFAASTKWTPSLNAAIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNIAEHSPSVSPSSVENSGVSQSPLLQ | |
| retinoic acid receptor beta isoform beta4 | |
|---|---|
| Refseq ID | NP_001276691 |
| Protein GI | 576796321 |
| UniProt ID | P22605 |
| mRNA ID | NM_001289762 |
| Length | 399 |
| RefSeq Status | VALIDATED |
| MENAIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNIAEHSPSVSPSSVENSGVSQSPLLQ | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005634 | IEA:UniProtKB-KW | C | nucleus |
| GO:0000977 | IDA:MGI | F | RNA polymerase II regulatory region sequence-specific DNA binding |
| GO:0008144 | IEA:Ensembl | F | drug binding |
| GO:0003708 | IEA:InterPro | F | retinoic acid receptor activity |
| GO:0043565 | IDA:MGI | F | sequence-specific DNA binding |
| GO:0003700 | IDA:MGI | F | sequence-specific DNA binding transcription factor activity |
| GO:0003707 | IEA:InterPro | F | steroid hormone receptor activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
| GO:0060348 | IGI:MGI | P | bone development |
| GO:0048566 | IEA:Ensembl | P | embryonic digestive tract development |
| GO:0048048 | IGI:MGI | P | embryonic eye morphogenesis |
| GO:0035116 | IGI:MGI | P | embryonic hindlimb morphogenesis |
| GO:0002068 | IGI:MGI | P | glandular epithelial cell development |
| GO:0003417 | IGI:MGI | P | growth plate cartilage development |
| GO:0035264 | IGI:MGI | P | multicellular organism growth |
| GO:0043066 | IGI:MGI | P | negative regulation of apoptotic process |
| GO:0061037 | IMP:MGI | P | negative regulation of cartilage development |
| GO:0008285 | IGI:MGI | P | negative regulation of cell proliferation |
| GO:0032331 | IMP:MGI | P | negative regulation of chondrocyte differentiation |
| GO:0000122 | IDA:MGI | P | negative regulation of transcription from RNA polymerase II promoter |
| GO:0022008 | IMP:MGI | P | neurogenesis |
| GO:0003148 | IGI:MGI | P | outflow tract septum morphogenesis |
| GO:0043065 | IGI:MGI | P | positive regulation of apoptotic process |
| GO:0008284 | IGI:MGI | P | positive regulation of cell proliferation |
| GO:0045666 | IEA:Ensembl | P | positive regulation of neuron differentiation |
| GO:0043068 | IGI:MGI | P | positive regulation of programmed cell death |
| GO:0045944 | IDA:MGI | P | positive regulation of transcription from RNA polymerase II promoter |
| GO:0031641 | IEA:Ensembl | P | regulation of myelination |
| GO:0060041 | IGI:MGI | P | retina development in camera-type eye |
| GO:0003406 | IGI:MGI | P | retinal pigment epithelium development |
| GO:0021756 | IMP:MGI | P | striatum development |
| GO:0001657 | IMP:MGI | P | ureteric bud development |
| GO:0055012 | IMP:MGI | P | ventricular cardiac muscle cell differentiation |
KEGG Pathway Links
Domain Information
InterPro Annotations
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=4; Name=Beta-3; IsoId=P22605-1; Sequence=Displayed; Name=Beta-1; IsoId=P22605-2; Sequence=VSP_003639, VSP_003640; Name=Beta-2; IsoId=P22605-3; Sequence=VSP_003636; Name=Beta-4; IsoId=P22605-4; Sequence=VSP_003637, VSP_003638; |
| Disruption Phenotype | Rarb and Rarg, but not Rarb and Rara, double null mice exhibit growth retardation 3 weeks after birth. Defects are found in the growth plates with deficiency in cartilage. Growth retardation was noticable in limb sketal elements such as femurs. Early lethality and male sterility due to squamous metaplasia of the seminal vesicles and prostate are also observed. Isoform 2 mutants appear normal. {ECO:0000269|PubMed:19389355}. |
| Domain | Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal ligand-binding domain. |
| Function | Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RAR/RXR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. In the absence of ligand, acts mainly as an activator of gene expression due to weak binding to corepressors (By similarity). In concert with RARG, required for skeletal growth, matrix homeostasis and growth plate function. {ECO:0000250, ECO:0000269|PubMed:19389355}. |
| Similarity | Belongs to the nuclear hormone receptor family. NR1 subfamily. {ECO:0000305}. |
| Similarity | Contains 1 nuclear receptor DNA-binding domain. {ECO:0000255|PROSITE-ProRule:PRU00407}. |
| Subcellular Location | Nucleus. |
| Subunit | Homodimer (By similarity). Heterodimer; with a RXR molecule. Binds DNA preferentially as a RAR/RXR heterodimer. Interacts weakly with NCOR2 (By similarity). {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000483 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 576795787 | RefSeq | NP_001276690 | 455 | retinoic acid receptor beta isoform beta1 |
| 45593124 | RefSeq | NP_035373 | 448 | retinoic acid receptor beta isoform beta2 |
| 576795732 | RefSeq | NP_001276689 | 482 | retinoic acid receptor beta isoform beta3 |
| 576796321 | RefSeq | NP_001276691 | 399 | retinoic acid receptor beta isoform beta4 |
Identical Sequences to LMP000483 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:45593124 | GenBank | AAB25784.2 | 448 | retinoic acid nuclear receptor isoform beta 2 [Mus sp.] |
| GI:45593124 | GenBank | AAH76597.1 | 448 | Retinoic acid receptor, beta [Mus musculus] |
| GI:45593124 | GenBank | EDL20643.1 | 448 | retinoic acid receptor, beta, isoform CRA_a [Mus musculus] |
| GI:45593124 | PRF | - | 448 | retinoic acid receptor beta [Mus musculus] |
| GI:576795787 | RefSeq | XP_006518070.1 | 455 | PREDICTED: retinoic acid receptor beta isoform X1 [Mus musculus] |
| GI:576795732 | SwissProt | P22605.1 | 482 | RecName: Full=Retinoic acid receptor beta; Short=RAR-beta; AltName: Full=Nuclear receptor subfamily 1 group B member 2 [Mus musculus] |
Related Sequences to LMP000483 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:45593124 | GenBank | AAL02361.1 | 448 | retinoic acid receptor beta-2 [Mesocricetus auratus] |
| GI:576796321 | GenBank | EDL20643.1 | 448 | retinoic acid receptor, beta, isoform CRA_a [Mus musculus] |
| GI:45593124 | GenBank | EDL94092.1 | 448 | retinoic acid receptor, beta [Rattus norvegicus] |
| GI:576796321 | PRF | - | 448 | retinoic acid receptor beta [Mus musculus] |
| GI:576796321 | RefSeq | NP_035373.1 | 448 | retinoic acid receptor beta isoform beta2 [Mus musculus] |
| GI:576795787 | RefSeq | XP_002716265.1 | 455 | PREDICTED: retinoic acid receptor beta isoform X1 [Oryctolagus cuniculus] |
| GI:576795787 | RefSeq | XP_002926489.1 | 455 | PREDICTED: retinoic acid receptor beta-like isoform 1 [Ailuropoda melanoleuca] |
| GI:576795787 | RefSeq | XP_003433175.1 | 455 | PREDICTED: retinoic acid receptor beta isoform X3 [Canis lupus familiaris] |
| GI:45593124 | RefSeq | XP_003499232.1 | 448 | PREDICTED: retinoic acid receptor beta isoform X3 [Cricetulus griseus] |
| GI:576795787 | RefSeq | XP_003499233.1 | 455 | PREDICTED: retinoic acid receptor beta isoform X2 [Cricetulus griseus] |
| GI:45593124 | RefSeq | NP_113717.1 | 448 | retinoic acid receptor beta [Rattus norvegicus] |
| GI:45593124 | RefSeq | NP_001268285.1 | 448 | retinoic acid receptor, beta [Mesocricetus auratus] |
| GI:45593124 | RefSeq | XP_005348613.1 | 448 | PREDICTED: retinoic acid receptor beta [Microtus ochrogaster] |
| GI:576795732 | RefSeq | XP_006176357.1 | 482 | PREDICTED: retinoic acid receptor beta isoform X1 [Camelus ferus] |
| GI:576795732 | RefSeq | XP_006518070.1 | 455 | PREDICTED: retinoic acid receptor beta isoform X1 [Mus musculus] |
| GI:576796321 | RefSeq | NP_001276689.1 | 482 | retinoic acid receptor beta isoform beta3 [Mus musculus] |
| GI:576795732 | RefSeq | XP_006883412.1 | 482 | PREDICTED: retinoic acid receptor beta isoform X3 [Elephantulus edwardii] |
| GI:576795732 | RefSeq | XP_006851683.1 | 482 | PREDICTED: retinoic acid receptor beta isoform X3 [Chrysochloris asiatica] |
| GI:576795787 | RefSeq | XP_006936526.1 | 455 | PREDICTED: retinoic acid receptor beta isoform X2 [Felis catus] |
| GI:576796321 | RefSeq | NP_001277195.1 | 399 | retinoic acid receptor beta isoform 4 [Homo sapiens] |
| GI:576795732 | RefSeq | XP_007517174.1 | 482 | PREDICTED: retinoic acid receptor beta isoform X1 [Erinaceus europaeus] |
| GI:576795732 | RefSeq | XP_007934557.1 | 482 | PREDICTED: retinoic acid receptor beta isoform X1 [Orycteropus afer afer] |
| GI:576795787 | RefSeq | XP_008516546.1 | 455 | PREDICTED: retinoic acid receptor beta isoform X1 [Equus przewalskii] |
| GI:576796321 | SwissProt | P22605.1 | 482 | RecName: Full=Retinoic acid receptor beta; Short=RAR-beta; AltName: Full=Nuclear receptor subfamily 1 group B member 2 [Mus musculus] |