Gene/Proteome Database (LMPD)
LMPD ID
LMP000496
Gene ID
Species
Homo sapiens (Human)
Gene Name
sterol-C5-desaturase
Gene Symbol
Synonyms
ERG3; S5DES; SC5DL
Alternate Names
lathosterol oxidase; C-5 sterol desaturase; lathosterol 5-desaturase; lathosterol dehydrogenase; delta(7)-sterol 5-desaturase; fungal ERG3, delta-5-desaturase-like; 3beta-hydroxysteroid-delta5-desaturase; sterol-C5-desaturase (ERG3 delta-5-desaturase homolog, S. cerevisiae)-like
Chromosome
11
Map Location
11q23.3
EC Number
1.14.21.6
Summary
This gene encodes an enzyme of cholesterol biosynthesis. The encoded protein catalyzes the conversion of lathosterol into 7-dehydrocholesterol. Mutations in this gene have been associated with lathosterolosis. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
lathosterol oxidase | |
---|---|
Refseq ID | NP_008849 |
Protein GI | 68160941 |
UniProt ID | O75845 |
mRNA ID | NM_006918 |
Length | 299 |
RefSeq Status | REVIEWED |
MDLVLRVADYYFFTPYVYPATWPEDDIFRQAISLLIVTNVGAYILYFFCATLSYYFVFDHALMKHPQFLKNQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLGEFPYGLFELVVSIISFLFFTDMFIYWIHRGLHHRLVYKRLHKPHHIWKIPTPFASHAFHPIDGFLQSLPYHIYPFIFPLHKVVYLSLYILVNIWTISIHDGDFRVPQILQPFINGSAHHTDHHMFFDYNYGQYFTLWDRIGGSFKNPSSFEGKGPLSYVKEMTEGKRSSHSGNGCKNEKLFNGEFTKTE |
lathosterol oxidase | |
---|---|
Refseq ID | NP_001020127 |
Protein GI | 68160945 |
UniProt ID | O75845 |
mRNA ID | NM_001024956 |
Length | 299 |
RefSeq Status | REVIEWED |
Protein sequence is identical to GI:68160941 (mRNA isoform) |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005789 | TAS:Reactome | C | endoplasmic reticulum membrane |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0000248 | TAS:ProtInc | F | C-5 sterol desaturase activity |
GO:0005506 | IEA:InterPro | F | iron ion binding |
GO:0050046 | IEA:UniProtKB-EC | F | lathosterol oxidase activity |
GO:0006695 | TAS:Reactome | P | cholesterol biosynthetic process |
GO:0033490 | IEA:Ensembl | P | cholesterol biosynthetic process via lathosterol |
GO:0006633 | IEA:InterPro | P | fatty acid biosynthetic process |
GO:0006629 | TAS:ProtInc | P | lipid metabolic process |
GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
REACT_147904 | Activation of gene expression by SREBF (SREBP) |
REACT_9405 | Cholesterol biosynthesis |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR006694 | Fatty_acid_hydroxylase |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | 5-alpha-cholest-7-en-3-beta-ol + NAD(P)H + O(2) = cholesta-5,7-dien-3-beta-ol + NAD(P)(+) + 2 H(2)O. |
Cofactor | Name=Fe cation; Xref=ChEBI |
Disease | Lathosterolosis (LATHST) [MIM |
Domain | The histidine box domains may contain the active site and/or be involved in metal ion binding. |
Function | Catalyzes a dehydrogenation to introduce C5-6 double bond into lathosterol. |
Similarity | Belongs to the sterol desaturase family. |
Subcellular Location | Endoplasmic reticulum membrane {ECO |
Identical and Related Proteins
Unique RefSeq proteins for LMP000496 (as displayed in Record Overview)
Identical Sequences to LMP000496 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:68160941 | DBBJ | BAG35518.1 | 299 | unnamed protein product [Homo sapiens] |
GI:68160941 | EMBL | CBX51899.1 | 299 | unnamed protein product [Equus caballus] |
GI:68160941 | GenBank | ADQ31867.1 | 299 | sterol-C5-desaturase (ERG3 delta-5-desaturase homolog, S. cerevisiae)-like, partial [synthetic construct] |
GI:68160941 | GenBank | AEW32446.1 | 299 | Sequence 48 from patent US 8071305 |
GI:68160941 | GenBank | AIC49677.1 | 299 | SC5DL, partial [synthetic construct] |
GI:68160941 | SwissProt | O75845.2 | 299 | RecName: Full=Lathosterol oxidase; AltName: Full=C-5 sterol desaturase; AltName: Full=Delta(7)-sterol 5-desaturase; AltName: Full=Lathosterol 5-desaturase; AltName: Full=Sterol-C5-desaturase [Homo sapiens] |
Related Sequences to LMP000496 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:68160941 | DBBJ | BAA33729.1 | 299 | sterol-C5-desaturase [Homo sapiens] |
GI:68160941 | DBBJ | BAB68218.1 | 299 | sterol C5 desaturase [Homo sapiens] |
GI:68160941 | GenBank | ACM82648.1 | 300 | Sequence 8146 from patent US 6812339 |
GI:68160941 | RefSeq | XP_004052346.1 | 299 | PREDICTED: lathosterol oxidase isoform 1 [Gorilla gorilla gorilla] |
GI:68160941 | RefSeq | XP_004052347.1 | 299 | PREDICTED: lathosterol oxidase isoform 2 [Gorilla gorilla gorilla] |
GI:68160941 | RefSeq | XP_004052348.1 | 299 | PREDICTED: lathosterol oxidase-like [Gorilla gorilla gorilla] |