Gene/Proteome Database (LMPD)
Proteins
carbonyl reductase [NADPH] 1 | |
---|---|
Refseq ID | NP_031646 |
Protein GI | 113680352 |
UniProt ID | P48758 |
mRNA ID | NM_007620 |
Length | 277 |
RefSeq Status | VALIDATED |
MSSSRPVALVTGANKGIGFAITRDLCRKFSGDVVLAARDEERGQTAVQKLQAEGLSPRFHQLDIDNPQSIRALRDFLLKEYGGLDVLVNNAGIAFKVNDDTPFHIQAEVTMKTNFFGTRDVCKELLPLIKPQGRVVNVSSMVSLRALKNCRLELQQKFRSETITEEELVGLMNKFVEDTKKGVHAEEGWPNSAYGVTKIGVTVLSRILARKLNEQRRGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVQDKKVEPW |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
GO:0004090 | TAS:MGI | F | carbonyl reductase (NADPH) activity |
GO:0016655 | IEA:Ensembl | F | oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor |
GO:0017144 | IEA:Ensembl | P | drug metabolic process |
GO:0030855 | IEA:Ensembl | P | epithelial cell differentiation |
GO:0042373 | IEA:Ensembl | P | vitamin K metabolic process |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP000524 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
113680352 | RefSeq | NP_031646 | 277 | carbonyl reductase [NADPH] 1 |
Identical Sequences to LMP000524 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:113680352 | GenBank | AAH12714.1 | 277 | Carbonyl reductase 1 [Mus musculus] |
GI:113680352 | GenBank | EDL03764.1 | 277 | carbonyl reductase 1, isoform CRA_a [Mus musculus] |
GI:113680352 | GenBank | AAI58027.1 | 277 | Carbonyl reductase 1 [Mus musculus] |
GI:113680352 | GenBank | AAI58030.1 | 277 | Carbonyl reductase 1 [Mus musculus] |
GI:113680352 | SwissProt | P48758.3 | 277 | RecName: Full=Carbonyl reductase [NADPH] 1; AltName: Full=15-hydroxyprostaglandin dehydrogenase [NADP(+)]; AltName: Full=NADPH-dependent carbonyl reductase 1; AltName: Full=Prostaglandin 9-ketoreductase; AltName: Full=Prostaglandin-E(2) 9-reductase [Mus musculus] |
Related Sequences to LMP000524 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:113680352 | EMBL | CAA59088.1 | 277 | carbonyl reductase (NADPH) [Rattus norvegicus] |
GI:113680352 | EMBL | CAA65230.1 | 277 | carbonyl reductase (NADPH) [Rattus norvegicus] |
GI:113680352 | GenBank | AAB19006.1 | 277 | carbonyl reductase [Mus musculus] |
GI:113680352 | GenBank | AEK13634.1 | 277 | Sequence 46 from patent US 7972785 |
GI:113680352 | RefSeq | NP_062043.1 | 277 | carbonyl reductase [NADPH] 1 [Rattus norvegicus] |
GI:113680352 | SwissProt | P47727.2 | 277 | RecName: Full=Carbonyl reductase [NADPH] 1; AltName: Full=15-hydroxyprostaglandin dehydrogenase [NADP(+)]; AltName: Full=20-beta-hydroxysteroid dehydrogenase; AltName: Full=NADPH-dependent carbonyl reductase 1; AltName: Full=Prostaglandin 9-ketoreductase; AltName: Full=Prostaglandin-E(2) 9-reductase [Rattus norvegicus] |