Gene/Proteome Database (LMPD)
LMPD ID
LMP000534
Gene ID
Species
Homo sapiens (Human)
Gene Name
phosphomevalonate kinase
Gene Symbol
Synonyms
HUMPMKI; PMK; PMKA; PMKASE
Alternate Names
phosphomevalonate kinase; hPMK
Chromosome
1
Map Location
1q22
EC Number
2.7.4.2
Summary
This gene encodes a peroxisomal enzyme that catalyzes the conversion of mevalonate 5-phosphate into mevalonate 5-diphosphate, the fifth reaction of the cholesterol biosynthetic pathway. Studies in rat show that the message level and the enzyme activity of this protein is regulated by sterol, and that this regulation is coordinated with 3-hydroxy-3-methylglutaryl coenzyme A reductase, the rate-limiting enzyme of cholesterol biosynthesis. [provided by RefSeq, Sep 2011]
Orthologs
Proteins
| phosphomevalonate kinase | |
|---|---|
| Refseq ID | NP_006547 |
| Protein GI | 5729980 |
| UniProt ID | Q15126 |
| mRNA ID | NM_006556 |
| Length | 192 |
| RefSeq Status | VALIDATED |
| MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRL | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005829 | IDA:UniProtKB | C | cytosol |
| GO:0070062 | IDA:UniProt | C | extracellular vesicular exosome |
| GO:0016020 | IDA:UniProtKB | C | membrane |
| GO:0005777 | IDA:UniProtKB | C | peroxisome |
| GO:0005524 | IDA:UniProtKB | F | ATP binding |
| GO:0004631 | IDA:UniProtKB | F | phosphomevalonate kinase activity |
| GO:0006695 | IDA:UniProtKB | P | cholesterol biosynthetic process |
| GO:0019287 | IEA:UniProtKB-UniPathway | P | isopentenyl diphosphate biosynthetic process, mevalonate pathway |
| GO:0070723 | IEP:UniProtKB | P | response to cholesterol |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0016126 | IDA:UniProtKB | P | sterol biosynthetic process |
KEGG Pathway Links
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_147904 | Activation of gene expression by SREBF (SREBP) |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Biophysicochemical Properties | Kinetic parameters: KM=25 uM for (R)-5-phosphomevalonate ; KM=0.26 mM for ATP {ECO |
| Catalytic Activity | ATP + (R)-5-phosphomevalonate = ADP + (R)-5- diphosphomevalonate. |
| Induction | By sterol. |
| Pathway | Isoprenoid biosynthesis; isopentenyl diphosphate biosynthesis via mevalonate pathway; isopentenyl diphosphate from (R)-mevalonate: step 2/3. |
| Subcellular Location | Peroxisome . |
| Subunit | Monomer. |
| Tissue Specificity | Heart, liver, skeletal muscle, kidney, and pancreas. Lower level in brain, placenta and lung. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000534 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 5729980 | RefSeq | NP_006547 | 192 | phosphomevalonate kinase |
Identical Sequences to LMP000534 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:5729980 | DBBJ | BAG35661.1 | 192 | unnamed protein product [Homo sapiens] |
| GI:5729980 | GenBank | EAW53178.1 | 192 | phosphomevalonate kinase, isoform CRA_a [Homo sapiens] |
| GI:5729980 | GenBank | ADZ15843.1 | 192 | phosphomevalonate kinase, partial [synthetic construct] |
| GI:5729980 | GenBank | AIC62680.1 | 192 | PMVK, partial [synthetic construct] |
| GI:5729980 | RefSeq | XP_004026885.1 | 192 | PREDICTED: phosphomevalonate kinase isoform 1 [Gorilla gorilla gorilla] |
| GI:5729980 | RefSeq | XP_004026886.1 | 192 | PREDICTED: phosphomevalonate kinase isoform 2 [Gorilla gorilla gorilla] |
Related Sequences to LMP000534 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:5729980 | GenBank | AAQ02411.1 | 193 | phosphomevalonate kinase, partial [synthetic construct] |
| GI:5729980 | GenBank | AAX37126.1 | 193 | phosphomevalonate kinase, partial [synthetic construct] |
| GI:5729980 | GenBank | AAX42912.1 | 193 | phosphomevalonate kinase, partial [synthetic construct] |
| GI:5729980 | GenBank | AAX42913.1 | 193 | phosphomevalonate kinase, partial [synthetic construct] |
| GI:5729980 | GenBank | AAX42914.1 | 193 | phosphomevalonate kinase, partial [synthetic construct] |
| GI:5729980 | PDB | 3CH4 | 202 | Chain B, The Crystal Structure Of Human Phosphomavelonate Kinase At 1.8 A Resolution |