Gene/Proteome Database (LMPD)

LMPD ID
LMP000540
Gene ID
8613
Species
Homo sapiens (Human)
Gene Name
phosphatidic acid phosphatase type 2B
Gene Symbol
PPAP2B
Synonyms
Dri42; LPP3; PAP2B; VCIP
Alternate Names
lipid phosphate phosphohydrolase 3; PAP2 beta; phosphatidate phosphohydrolase type 2b; type-2 phosphatidic acid phosphatase-beta; vascular endothelial growth factor and type I collagen inducible
Chromosome
1
Map Location
1p32.2
EC Number
3.1.3.4
Summary
The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is a membrane glycoprotein localized at the cell plasma membrane. It has been shown to actively hydrolyze extracellular lysophosphatidic acid and short-chain phosphatidic acid. The expression of this gene is found to be enhanced by epidermal growth factor in Hela cells. [provided by RefSeq, Mar 2010]
Orthologs
View orthologs and multiple alignments for PPAP2B

Proteins

lipid phosphate phosphohydrolase 3
Refseq ID NP_003704
Protein GI 29171740
UniProt ID O14495
mRNA ID NM_003713
Length 311
RefSeq Status REVIEWED
MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIKPYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQNPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYRCRGDDSKVQEARKSFFSGHASFSMYTMLYLVLYLQARFTWRGARLLRPLLQFTLIMMAFYTGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTTLSLPAPAIRKEILSPVDIIDRNNHHNMM

Gene Information

Entrez Gene ID
8613
Gene Name
phosphatidic acid phosphatase type 2B
Gene Symbol
PPAP2B
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IEA:UniProtKB-KW C Golgi apparatus
GO:0005912 TAS:BHF-UCL C adherens junction
GO:0070062 IDA:UniProt C extracellular vesicular exosome
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016020 TAS:ProtInc C membrane
GO:0005886 TAS:Reactome C plasma membrane
GO:0042577 IEA:Ensembl F lipid phosphatase activity
GO:0008195 IEA:UniProtKB-EC F phosphatidate phosphatase activity
GO:0004721 TAS:ProtInc F phosphoprotein phosphatase activity
GO:0042392 IEA:Ensembl F sphingosine-1-phosphate phosphatase activity
GO:0060020 IEA:Ensembl P Bergmann glial cell differentiation
GO:0001568 IEA:Ensembl P blood vessel development
GO:0044329 IMP:BHF-UCL P canonical Wnt signaling pathway involved in positive regulation of cell-cell adhesion
GO:0044328 IMP:BHF-UCL P canonical Wnt signaling pathway involved in positive regulation of endothelial cell migration
GO:0044330 IMP:BHF-UCL P canonical Wnt signaling pathway involved in positive regulation of wound healing
GO:0016311 TAS:GOC P dephosphorylation
GO:0001702 IEA:Ensembl P gastrulation with mouth forming second
GO:0008354 TAS:ProtInc P germ cell migration
GO:0034109 IDA:BHF-UCL P homotypic cell-cell adhesion
GO:0006629 NAS:ProtInc P lipid metabolic process
GO:0001933 IDA:BHF-UCL P negative regulation of protein phosphorylation
GO:0006644 IEA:Ensembl P phospholipid metabolic process
GO:0050731 IEA:Ensembl P positive regulation of peptidyl-tyrosine phosphorylation
GO:0051091 IDA:BHF-UCL P positive regulation of sequence-specific DNA binding transcription factor activity
GO:0050821 IDA:BHF-UCL P protein stabilization
GO:0030111 IEA:Ensembl P regulation of Wnt signaling pathway
GO:1902068 IEA:Ensembl P regulation of sphingolipid mediated signaling pathway
GO:0044281 TAS:Reactome P small molecule metabolic process
GO:0030148 TAS:Reactome P sphingolipid biosynthetic process
GO:0006665 TAS:Reactome P sphingolipid metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa04975 Fat digestion and absorption
hsa04666 Fc gamma R-mediated phagocytosis

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_115810 Sphingolipid de novo biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR028675 Lipid phosphate phosphohydrolase 3
IPR000326 Phosphatidic acid phosphatase type 2/haloperoxidase

UniProt Annotations

Entry Information

Gene Name
phosphatidic acid phosphatase type 2B
Protein Entry
LPP3_HUMAN
UniProt ID
O14495
Species
Human

Comments

Comment Type Description
Catalytic Activity A 1,2-diacylglycerol 3-phosphate + H(2)O = a 1,2-diacyl-sn-glycerol + phosphate.
Enzyme Regulation Inhibited by sphingosine, zinc ions and propanolol. Not inhibited by N-ethylmaleimide treatment.
Function Catalyzes the conversion of phosphatidic acid (PA) to diacylglycerol (DG). In addition it hydrolyzes lysophosphatidic acid (LPA), ceramide-1-phosphate (C-1-P) and sphingosine-1- phosphate (S-1-P). The relative catalytic efficiency is LPA = PA > C-1-P > S-1-P. May be involved in cell adhesion and in cell-cell interactions.
Induction By EGF, VEGF, FGF2 and phorbol myristate acetate (PMA).
Interaction O60716:CTNND1; NbExp=9; IntAct=EBI-766232, EBI-701927;
Ptm N-glycosylated. Contains high-mannose oligosaccharides.
Sequence Caution Sequence=AAB50222.1; Type=Frameshift; Positions=225; Evidence= ;
Similarity Belongs to the PA-phosphatase related phosphoesterase family.
Subcellular Location Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Subunit Homodimer. This complex seems not to be involved in substrate recognition, it may confer only structural or functional stability.
Tissue Specificity Ubiquitously expressed. Highly expressed in heart and placenta.

Identical and Related Proteins

Unique RefSeq proteins for LMP000540 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
29171740 RefSeq NP_003704 311 lipid phosphate phosphohydrolase 3

Identical Sequences to LMP000540 proteins

Reference Database Accession Length Protein Name
GI:29171740 GenBank ADT48855.1 311 Sequence 872 from patent US 7842467
GI:29171740 GenBank AEU56604.1 311 Sequence 116 from patent US 8067189
GI:29171740 GenBank AEU56629.1 311 Sequence 141 from patent US 8067189
GI:29171740 GenBank AEU56633.1 311 Sequence 145 from patent US 8067189
GI:29171740 GenBank AHD69612.1 311 Sequence 626 from patent US 8586006
GI:29171740 GenBank AHD69613.1 311 Sequence 627 from patent US 8586006

Related Sequences to LMP000540 proteins

Reference Database Accession Length Protein Name
GI:29171740 GenBank AFE80625.1 311 lipid phosphate phosphohydrolase 3 [Macaca mulatta]
GI:29171740 GenBank AFH34414.1 311 lipid phosphate phosphohydrolase 3 [Macaca mulatta]
GI:29171740 GenBank AFI35114.1 311 lipid phosphate phosphohydrolase 3 [Macaca mulatta]
GI:29171740 GenBank AFI35115.1 311 lipid phosphate phosphohydrolase 3 [Macaca mulatta]
GI:29171740 GenBank JAA05004.1 311 phosphatidic acid phosphatase type 2B [Pan troglodytes]
GI:29171740 GenBank JAA21826.1 311 phosphatidic acid phosphatase type 2B [Pan troglodytes]