Gene/Proteome Database (LMPD)

LMPD ID
LMP000542
Gene ID
Species
Homo sapiens (Human)
Gene Name
synaptotagmin I
Gene Symbol
Synonyms
P65; SVP65; SYT
Chromosome
12
Map Location
12cen-q21
Summary
The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. Calcium binding to synaptotagmin-1 participates in triggering neurotransmitter release at the synapse (Fernandez-Chacon et al., 2001 [PubMed 11242035]).[supplied by OMIM, Jul 2010]
Orthologs

Proteins

synaptotagmin-1 isoform 1
Refseq ID NP_001129277
Protein GI 209447070
UniProt ID P21579
mRNA ID NM_001135805
Length 422
RefSeq Status VALIDATED
MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWALIAIAIVAVLLVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK
synaptotagmin-1 isoform 1
Refseq ID NP_001129278
Protein GI 209447073
UniProt ID P21579
mRNA ID NM_001135806
Length 422
RefSeq Status VALIDATED
Protein sequence is identical to GI:209447070 (mRNA isoform)
synaptotagmin-1 isoform 1
Refseq ID NP_005630
Protein GI 5032139
UniProt ID P21579
mRNA ID NM_005639
Length 422
RefSeq Status VALIDATED
Protein sequence is identical to GI:209447070 (mRNA isoform)
synaptotagmin-1 isoform 2
Refseq ID NP_001278830
Protein GI 631790805
UniProt ID J3KQA0
mRNA ID NM_001291901
Length 419
RefSeq Status VALIDATED
MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWALIAIAIVAVLLVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK

Gene Information

Entrez Gene ID
Gene Name
synaptotagmin I
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0030054 IEA:UniProtKB-KW C cell junction
GO:0060201 TAS:Reactome C clathrin-sculpted acetylcholine transport vesicle membrane
GO:0061202 TAS:Reactome C clathrin-sculpted gamma-aminobutyric acid transport vesicle membrane
GO:0060203 TAS:Reactome C clathrin-sculpted glutamate transport vesicle membrane
GO:0070083 TAS:Reactome C clathrin-sculpted monoamine transport vesicle membrane
GO:0031045 IEA:Ensembl C dense core granule
GO:0030666 TAS:Reactome C endocytic vesicle membrane
GO:0060076 IEA:Ensembl C excitatory synapse
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0043005 ISS:ParkinsonsUK-UCL C neuron projection
GO:0005886 TAS:Reactome C plasma membrane
GO:0042734 IEA:Ensembl C presynaptic membrane
GO:0008021 TAS:UniProtKB C synaptic vesicle
GO:0030672 IEA:Ensembl C synaptic vesicle membrane
GO:0005545 TAS:UniProtKB F 1-phosphatidylinositol binding
GO:0000149 ISS:ParkinsonsUK-UCL F SNARE binding
GO:0005509 IEA:Ensembl F calcium ion binding
GO:0005544 ISS:ParkinsonsUK-UCL F calcium-dependent phospholipid binding
GO:0050750 IDA:MGI F low-density lipoprotein particle receptor binding
GO:0005546 IEA:Ensembl F phosphatidylinositol-4,5-bisphosphate binding
GO:0001786 IEA:Ensembl F phosphatidylserine binding
GO:0017075 TAS:UniProtKB F syntaxin-1 binding
GO:0005215 IEA:InterPro F transporter activity
GO:0048791 ISS:ParkinsonsUK-UCL P calcium ion-dependent exocytosis of neurotransmitter
GO:0005513 TAS:UniProtKB P detection of calcium ion
GO:0014047 TAS:Reactome P glutamate secretion
GO:0007269 TAS:UniProtKB P neurotransmitter secretion
GO:0045956 IEA:Ensembl P positive regulation of calcium ion-dependent exocytosis
GO:0050806 ISS:ParkinsonsUK-UCL P positive regulation of synaptic transmission
GO:0031340 IEA:Ensembl P positive regulation of vesicle fusion
GO:0051260 TAS:UniProtKB P protein homooligomerization
GO:0017157 TAS:UniProtKB P regulation of exocytosis
GO:1903305 ISS:ParkinsonsUK-UCL P regulation of regulated secretory pathway
GO:0051966 ISS:ParkinsonsUK-UCL P regulation of synaptic transmission, glutamatergic
GO:0007268 TAS:Reactome P synaptic transmission
GO:0016079 IEA:Ensembl P synaptic vesicle exocytosis
GO:0048278 IEA:Ensembl P vesicle docking

KEGG Pathway Links

KEGG Pathway ID Description
hsa04721 Synaptic vesicle cycle

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_200782 Toxicity of botulinum toxin type B (BoNT/B)
REACT_200743 Toxicity of botulinum toxin type G (BoNT/G)

Domain Information

InterPro Annotations

Accession Description
IPR000008 C2 domain
IPR001565 Synaptotagmin
IPR015428 Synaptotagmin 1

UniProt Annotations

Entry Information

Gene Name
synaptotagmin I
Protein Entry
SYT1_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Cofactor Name=Ca(2+); Xref=ChEBI
Domain The first C2 domain mediates Ca(2+)-dependent phospholipid binding.
Domain The second C2 domain mediates interaction with SV2A and STN2.
Function May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone. A Ca(2+)-dependent interaction between synaptotagmin and putative receptors for activated protein kinase C has also been reported. It can bind to at least three additional proteins in a Ca(2+)-independent manner; these are neurexins, syntaxin and AP2.
Interaction O00305-2:CACNB4; NbExp=2; IntAct=EBI-524909, EBI-714855; Q9Y6K9:IKBKG; NbExp=3; IntAct=EBI-524909, EBI-81279;
Similarity Belongs to the synaptotagmin family.
Similarity Contains 2 C2 domains. {ECO
Subcellular Location Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass membrane protein. Cytoplasmic vesicle, secretory vesicle, chromaffin granule membrane; Single-pass membrane protein. Cytoplasm. Note=Synaptic vesicles and chromaffin granules.
Subunit Homotetramer (Probable). Interacts with SCAMP5, STON2, SV2A, SV2B, SV2C and RIMS1. Forms a complex with SV2B, syntaxin 1 and SNAP25 (By similarity).

Identical and Related Proteins

Unique RefSeq proteins for LMP000542 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
209447070 RefSeq NP_001129277 422 synaptotagmin-1 isoform 1
631790805 RefSeq NP_001278830 419 synaptotagmin-1 isoform 2

Identical Sequences to LMP000542 proteins

Reference Database Accession Length Protein Name
GI:209447070 RefSeq XP_009002528.1 422 PREDICTED: synaptotagmin-1 isoform X1 [Callithrix jacchus]
GI:209447070 RefSeq XP_008956582.1 422 PREDICTED: synaptotagmin-1 isoform X1 [Pan paniscus]
GI:631790805 RefSeq XP_008956584.1 419 PREDICTED: synaptotagmin-1 isoform X2 [Pan paniscus]
GI:209447070 RefSeq XP_009179518.1 422 PREDICTED: synaptotagmin-1 isoform X1 [Papio anubis]
GI:631790805 RefSeq XP_009179519.1 419 PREDICTED: synaptotagmin-1 isoform X2 [Papio anubis]
GI:209447070 RefSeq XP_009424168.1 422 PREDICTED: synaptotagmin-1 isoform X1 [Pan troglodytes]
GI:631790805 RefSeq XP_009424169.1 419 PREDICTED: synaptotagmin-1 isoform X2 [Pan troglodytes]
GI:631790805 RefSeq XP_009424170.1 419 PREDICTED: synaptotagmin-1 isoform X2 [Pan troglodytes]
GI:209447070 RefSeq XP_010378724.1 422 PREDICTED: synaptotagmin-1 isoform X1 [Rhinopithecus roxellana]
GI:209447070 RefSeq XP_010378725.1 422 PREDICTED: synaptotagmin-1 isoform X1 [Rhinopithecus roxellana]
GI:631790805 RefSeq XP_010378726.1 419 PREDICTED: synaptotagmin-1 isoform X2 [Rhinopithecus roxellana]
GI:631790805 RefSeq XP_010336755.1 419 PREDICTED: synaptotagmin-1 isoform X2 [Saimiri boliviensis boliviensis]

Related Sequences to LMP000542 proteins

Reference Database Accession Length Protein Name
GI:631790805 EMBL CAH93321.1 419 hypothetical protein [Pongo abelii]
GI:209447070 GenBank ACM82904.1 431 Sequence 8402 from patent US 6812339
GI:631790805 RefSeq NP_001128903.1 419 synaptotagmin-1 [Pongo abelii]
GI:209447070 RefSeq XP_001084494.2 430 PREDICTED: synaptotagmin-1 isoform 7 [Macaca mulatta]
GI:209447070 RefSeq XP_004053660.1 422 PREDICTED: synaptotagmin-1 isoform 1 [Gorilla gorilla gorilla]
GI:209447070 RefSeq XP_004053661.1 422 PREDICTED: synaptotagmin-1 isoform 2 [Gorilla gorilla gorilla]
GI:631790805 RefSeq XP_004845056.1 419 PREDICTED: synaptotagmin-1 isoform X5 [Heterocephalus glaber]
GI:209447070 RefSeq XP_005338044.1 422 PREDICTED: synaptotagmin-1 isoform X1 [Ictidomys tridecemlineatus]
GI:631790805 RefSeq XP_005338045.1 419 PREDICTED: synaptotagmin-1 isoform X2 [Ictidomys tridecemlineatus]
GI:209447070 RefSeq XP_008516796.1 422 PREDICTED: synaptotagmin-1 isoform X1 [Equus przewalskii]
GI:631790805 RefSeq XP_008516798.1 419 PREDICTED: synaptotagmin-1 isoform X2 [Equus przewalskii]
GI:631790805 SwissProt Q5R4J5.1 419 RecName: Full=Synaptotagmin-1; AltName: Full=Synaptotagmin I; Short=SytI [Pongo abelii]