Gene/Proteome Database (LMPD)
LMPD ID
LMP000542
Gene ID
Species
Homo sapiens (Human)
Gene Name
synaptotagmin I
Gene Symbol
Synonyms
P65; SVP65; SYT
Chromosome
12
Map Location
12cen-q21
Summary
The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. Calcium binding to synaptotagmin-1 participates in triggering neurotransmitter release at the synapse (Fernandez-Chacon et al., 2001 [PubMed 11242035]).[supplied by OMIM, Jul 2010]
Orthologs
Proteins
| synaptotagmin-1 isoform 1 | |
|---|---|
| Refseq ID | NP_001129277 |
| Protein GI | 209447070 |
| UniProt ID | P21579 |
| mRNA ID | NM_001135805 |
| Length | 422 |
| RefSeq Status | VALIDATED |
| MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWALIAIAIVAVLLVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK | |
| synaptotagmin-1 isoform 1 | |
|---|---|
| Refseq ID | NP_001129278 |
| Protein GI | 209447073 |
| UniProt ID | P21579 |
| mRNA ID | NM_001135806 |
| Length | 422 |
| RefSeq Status | VALIDATED |
| Protein sequence is identical to GI:209447070 (mRNA isoform) | |
| synaptotagmin-1 isoform 1 | |
|---|---|
| Refseq ID | NP_005630 |
| Protein GI | 5032139 |
| UniProt ID | P21579 |
| mRNA ID | NM_005639 |
| Length | 422 |
| RefSeq Status | VALIDATED |
| Protein sequence is identical to GI:209447070 (mRNA isoform) | |
| synaptotagmin-1 isoform 2 | |
|---|---|
| Refseq ID | NP_001278830 |
| Protein GI | 631790805 |
| UniProt ID | J3KQA0 |
| mRNA ID | NM_001291901 |
| Length | 419 |
| RefSeq Status | VALIDATED |
| MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWALIAIAIVAVLLVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0030054 | IEA:UniProtKB-KW | C | cell junction |
| GO:0060201 | TAS:Reactome | C | clathrin-sculpted acetylcholine transport vesicle membrane |
| GO:0061202 | TAS:Reactome | C | clathrin-sculpted gamma-aminobutyric acid transport vesicle membrane |
| GO:0060203 | TAS:Reactome | C | clathrin-sculpted glutamate transport vesicle membrane |
| GO:0070083 | TAS:Reactome | C | clathrin-sculpted monoamine transport vesicle membrane |
| GO:0031045 | IEA:Ensembl | C | dense core granule |
| GO:0030666 | TAS:Reactome | C | endocytic vesicle membrane |
| GO:0060076 | IEA:Ensembl | C | excitatory synapse |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0043005 | ISS:ParkinsonsUK-UCL | C | neuron projection |
| GO:0005886 | TAS:Reactome | C | plasma membrane |
| GO:0042734 | IEA:Ensembl | C | presynaptic membrane |
| GO:0008021 | TAS:UniProtKB | C | synaptic vesicle |
| GO:0030672 | IEA:Ensembl | C | synaptic vesicle membrane |
| GO:0005545 | TAS:UniProtKB | F | 1-phosphatidylinositol binding |
| GO:0000149 | ISS:ParkinsonsUK-UCL | F | SNARE binding |
| GO:0005509 | IEA:Ensembl | F | calcium ion binding |
| GO:0005544 | ISS:ParkinsonsUK-UCL | F | calcium-dependent phospholipid binding |
| GO:0050750 | IDA:MGI | F | low-density lipoprotein particle receptor binding |
| GO:0005546 | IEA:Ensembl | F | phosphatidylinositol-4,5-bisphosphate binding |
| GO:0001786 | IEA:Ensembl | F | phosphatidylserine binding |
| GO:0017075 | TAS:UniProtKB | F | syntaxin-1 binding |
| GO:0005215 | IEA:InterPro | F | transporter activity |
| GO:0048791 | ISS:ParkinsonsUK-UCL | P | calcium ion-dependent exocytosis of neurotransmitter |
| GO:0005513 | TAS:UniProtKB | P | detection of calcium ion |
| GO:0014047 | TAS:Reactome | P | glutamate secretion |
| GO:0007269 | TAS:UniProtKB | P | neurotransmitter secretion |
| GO:0045956 | IEA:Ensembl | P | positive regulation of calcium ion-dependent exocytosis |
| GO:0050806 | ISS:ParkinsonsUK-UCL | P | positive regulation of synaptic transmission |
| GO:0031340 | IEA:Ensembl | P | positive regulation of vesicle fusion |
| GO:0051260 | TAS:UniProtKB | P | protein homooligomerization |
| GO:0017157 | TAS:UniProtKB | P | regulation of exocytosis |
| GO:1903305 | ISS:ParkinsonsUK-UCL | P | regulation of regulated secretory pathway |
| GO:0051966 | ISS:ParkinsonsUK-UCL | P | regulation of synaptic transmission, glutamatergic |
| GO:0007268 | TAS:Reactome | P | synaptic transmission |
| GO:0016079 | IEA:Ensembl | P | synaptic vesicle exocytosis |
| GO:0048278 | IEA:Ensembl | P | vesicle docking |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa04721 | Synaptic vesicle cycle |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_200782 | Toxicity of botulinum toxin type B (BoNT/B) |
| REACT_200743 | Toxicity of botulinum toxin type G (BoNT/G) |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Cofactor | Name=Ca(2+); Xref=ChEBI |
| Domain | The first C2 domain mediates Ca(2+)-dependent phospholipid binding. |
| Domain | The second C2 domain mediates interaction with SV2A and STN2. |
| Function | May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone. A Ca(2+)-dependent interaction between synaptotagmin and putative receptors for activated protein kinase C has also been reported. It can bind to at least three additional proteins in a Ca(2+)-independent manner; these are neurexins, syntaxin and AP2. |
| Interaction | O00305-2:CACNB4; NbExp=2; IntAct=EBI-524909, EBI-714855; Q9Y6K9:IKBKG; NbExp=3; IntAct=EBI-524909, EBI-81279; |
| Similarity | Belongs to the synaptotagmin family. |
| Similarity | Contains 2 C2 domains. {ECO |
| Subcellular Location | Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass membrane protein. Cytoplasmic vesicle, secretory vesicle, chromaffin granule membrane; Single-pass membrane protein. Cytoplasm. Note=Synaptic vesicles and chromaffin granules. |
| Subunit | Homotetramer (Probable). Interacts with SCAMP5, STON2, SV2A, SV2B, SV2C and RIMS1. Forms a complex with SV2B, syntaxin 1 and SNAP25 (By similarity). |
Identical and Related Proteins
Unique RefSeq proteins for LMP000542 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 209447070 | RefSeq | NP_001129277 | 422 | synaptotagmin-1 isoform 1 |
| 631790805 | RefSeq | NP_001278830 | 419 | synaptotagmin-1 isoform 2 |
Identical Sequences to LMP000542 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:209447070 | RefSeq | XP_009002528.1 | 422 | PREDICTED: synaptotagmin-1 isoform X1 [Callithrix jacchus] |
| GI:209447070 | RefSeq | XP_008956582.1 | 422 | PREDICTED: synaptotagmin-1 isoform X1 [Pan paniscus] |
| GI:631790805 | RefSeq | XP_008956584.1 | 419 | PREDICTED: synaptotagmin-1 isoform X2 [Pan paniscus] |
| GI:209447070 | RefSeq | XP_009179518.1 | 422 | PREDICTED: synaptotagmin-1 isoform X1 [Papio anubis] |
| GI:631790805 | RefSeq | XP_009179519.1 | 419 | PREDICTED: synaptotagmin-1 isoform X2 [Papio anubis] |
| GI:209447070 | RefSeq | XP_009424168.1 | 422 | PREDICTED: synaptotagmin-1 isoform X1 [Pan troglodytes] |
| GI:631790805 | RefSeq | XP_009424169.1 | 419 | PREDICTED: synaptotagmin-1 isoform X2 [Pan troglodytes] |
| GI:631790805 | RefSeq | XP_009424170.1 | 419 | PREDICTED: synaptotagmin-1 isoform X2 [Pan troglodytes] |
| GI:209447070 | RefSeq | XP_010378724.1 | 422 | PREDICTED: synaptotagmin-1 isoform X1 [Rhinopithecus roxellana] |
| GI:209447070 | RefSeq | XP_010378725.1 | 422 | PREDICTED: synaptotagmin-1 isoform X1 [Rhinopithecus roxellana] |
| GI:631790805 | RefSeq | XP_010378726.1 | 419 | PREDICTED: synaptotagmin-1 isoform X2 [Rhinopithecus roxellana] |
| GI:631790805 | RefSeq | XP_010336755.1 | 419 | PREDICTED: synaptotagmin-1 isoform X2 [Saimiri boliviensis boliviensis] |
Related Sequences to LMP000542 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:631790805 | EMBL | CAH93321.1 | 419 | hypothetical protein [Pongo abelii] |
| GI:209447070 | GenBank | ACM82904.1 | 431 | Sequence 8402 from patent US 6812339 |
| GI:631790805 | RefSeq | NP_001128903.1 | 419 | synaptotagmin-1 [Pongo abelii] |
| GI:209447070 | RefSeq | XP_001084494.2 | 430 | PREDICTED: synaptotagmin-1 isoform 7 [Macaca mulatta] |
| GI:209447070 | RefSeq | XP_004053660.1 | 422 | PREDICTED: synaptotagmin-1 isoform 1 [Gorilla gorilla gorilla] |
| GI:209447070 | RefSeq | XP_004053661.1 | 422 | PREDICTED: synaptotagmin-1 isoform 2 [Gorilla gorilla gorilla] |
| GI:631790805 | RefSeq | XP_004845056.1 | 419 | PREDICTED: synaptotagmin-1 isoform X5 [Heterocephalus glaber] |
| GI:209447070 | RefSeq | XP_005338044.1 | 422 | PREDICTED: synaptotagmin-1 isoform X1 [Ictidomys tridecemlineatus] |
| GI:631790805 | RefSeq | XP_005338045.1 | 419 | PREDICTED: synaptotagmin-1 isoform X2 [Ictidomys tridecemlineatus] |
| GI:209447070 | RefSeq | XP_008516796.1 | 422 | PREDICTED: synaptotagmin-1 isoform X1 [Equus przewalskii] |
| GI:631790805 | RefSeq | XP_008516798.1 | 419 | PREDICTED: synaptotagmin-1 isoform X2 [Equus przewalskii] |
| GI:631790805 | SwissProt | Q5R4J5.1 | 419 | RecName: Full=Synaptotagmin-1; AltName: Full=Synaptotagmin I; Short=SytI [Pongo abelii] |