Gene/Proteome Database (LMPD)
Proteins
sphingosine-1-phosphate lyase 1 | |
---|---|
Refseq ID | NP_003892 |
Protein GI | 31982936 |
UniProt ID | O95470 |
mRNA ID | NM_003901 |
Length | 568 |
RefSeq Status | VALIDATED |
MPSTDLLMLKAFEPYLEILEVYSTKAKNYVNGHCTKYEPWQLIAWSVVWTLLIVWGYEFVFQPESLWSRFKKKCFKLTRKMPIIGRKIQDKLNKTKDDISKNMSFLKVDKEYVKALPSQGLSSSAVLEKLKEYSSMDAFWQEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGPDSCGCVTSGGTESILMACKAYRDLAFEKGIKTPEIVAPQSAHAAFNKAASYFGMKIVRVPLTKMMEVDVRAMRRAISRNTAMLVCSTPQFPHGVIDPVPEVAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEHPFDFRVKGVTSISADTHKYGYAPKGSSLVLYSDKKYRNYQFFVDTDWQGGIYASPTIAGSRPGGISAACWAALMHFGENGYVEATKQIIKTARFLKSELENIKGIFVFGNPQLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFPPSIHFCITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTTVDRNMVAELSSVFLDSLYSTDTVTQGSQMNGSPKPH |
Gene Information
Entrez Gene ID
Gene Name
sphingosine-1-phosphate lyase 1
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IDA:UniProtKB | C | endoplasmic reticulum |
GO:0005789 | TAS:Reactome | C | endoplasmic reticulum membrane |
GO:0030176 | NAS:UniProtKB | C | integral component of endoplasmic reticulum membrane |
GO:0016831 | IEA:InterPro | F | carboxy-lyase activity |
GO:0030170 | IEA:InterPro | F | pyridoxal phosphate binding |
GO:0008117 | IDA:UniProtKB | F | sphinganine-1-phosphate aldolase activity |
GO:0033327 | IEA:Ensembl | P | Leydig cell differentiation |
GO:0008209 | IEA:Ensembl | P | androgen metabolic process |
GO:0097190 | IDA:UniProtKB | P | apoptotic signaling pathway |
GO:0006672 | IDA:UniProtKB | P | ceramide metabolic process |
GO:0008210 | IEA:Ensembl | P | estrogen metabolic process |
GO:0060325 | IEA:Ensembl | P | face morphogenesis |
GO:0006631 | IDA:UniProtKB | P | fatty acid metabolic process |
GO:0010761 | IEA:Ensembl | P | fibroblast migration |
GO:0030097 | IEA:Ensembl | P | hemopoiesis |
GO:0001822 | IEA:Ensembl | P | kidney development |
GO:0001553 | IEA:Ensembl | P | luteinization |
GO:0060021 | IEA:Ensembl | P | palate development |
GO:0048008 | IEA:Ensembl | P | platelet-derived growth factor receptor signaling pathway |
GO:0009791 | IEA:Ensembl | P | post-embryonic development |
GO:0040014 | IEA:Ensembl | P | regulation of multicellular organism growth |
GO:0048705 | IEA:Ensembl | P | skeletal system morphogenesis |
GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
GO:0007283 | IEA:Ensembl | P | spermatogenesis |
GO:0030148 | TAS:Reactome | P | sphingolipid biosynthetic process |
GO:0030149 | IDA:UniProtKB | P | sphingolipid catabolic process |
GO:0006665 | TAS:Reactome | P | sphingolipid metabolic process |
GO:0001570 | IEA:Ensembl | P | vasculogenesis |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
hsa00600 | Sphingolipid metabolism |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
REACT_115810 | Sphingolipid de novo biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Biophysicochemical Properties | Kinetic parameters: KM=5.2 uM for sphingosine 1-phosphate ; |
Catalytic Activity | Sphinganine 1-phosphate = phosphoethanolamine + palmitaldehyde. {ECO |
Cofactor | Name=pyridoxal 5'-phosphate; Xref=ChEBI |
Function | Cleaves phosphorylated sphingoid bases (PSBs), such as sphingosine-1-phosphate, into fatty aldehydes and phosphoethanolamine. Elevates stress-induced ceramide production and apoptosis. {ECO |
Interaction | Q86WV6:TMEM173; NbExp=2; IntAct=EBI-1046170, EBI-2800345; |
Pathway | Lipid metabolism; sphingolipid metabolism. |
Sequence Caution | Sequence=BAA86566.1; Type=Erroneous initiation; Evidence= ; |
Similarity | Belongs to the group II decarboxylase family. Sphingosine-1-phosphate lyase subfamily. |
Subcellular Location | Endoplasmic reticulum membrane; Single-pass type III membrane protein. |
Subunit | Homodimer. |
Tissue Specificity | Found in liver and kidney. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000574 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
31982936 | RefSeq | NP_003892 | 568 | sphingosine-1-phosphate lyase 1 |
Identical Sequences to LMP000574 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:31982936 | GenBank | ACP87642.1 | 568 | Sequence 2 from patent US 7504225 |
GI:31982936 | GenBank | ADF21398.1 | 568 | Sequence 18 from patent US 7674580 |
GI:31982936 | GenBank | AEK15394.1 | 568 | Sequence 18 from patent US 7973143 |
GI:31982936 | GenBank | AFD38198.1 | 568 | Sequence 8 from patent US 8124111 |
GI:31982936 | GenBank | AIC55492.1 | 568 | SGPL1, partial [synthetic construct] |
GI:31982936 | RefSeq | XP_005270320.1 | 568 | PREDICTED: sphingosine-1-phosphate lyase 1 isoform X1 [Homo sapiens] |
Related Sequences to LMP000574 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:31982936 | DBBJ | BAA86566.1 | 580 | KIAA1252 protein, partial [Homo sapiens] |
GI:31982936 | GenBank | ACM82388.1 | 580 | Sequence 7886 from patent US 6812339 |
GI:31982936 | RefSeq | XP_001171432.1 | 568 | PREDICTED: sphingosine-1-phosphate lyase 1 isoform X2 [Pan troglodytes] |
GI:31982936 | RefSeq | XP_009456914.1 | 568 | PREDICTED: sphingosine-1-phosphate lyase 1 isoform X2 [Pan troglodytes] |
GI:31982936 | RefSeq | XP_009456915.1 | 568 | PREDICTED: sphingosine-1-phosphate lyase 1 isoform X2 [Pan troglodytes] |
GI:31982936 | RefSeq | XP_010361157.1 | 568 | PREDICTED: sphingosine-1-phosphate lyase 1 [Rhinopithecus roxellana] |