Gene/Proteome Database (LMPD)

LMPD ID
LMP000622
Gene ID
8273
Species
Homo sapiens (Human)
Gene Name
solute carrier family 10, member 3
Gene Symbol
SLC10A3
Synonyms
DXS253E; P3
Alternate Names
P3 protein; Protein P3; solute carrier family 10 (sodium/bile acid cotransporter family), member 3
Chromosome
X
Map Location
Xq28
Summary
This gene maps to a GC-rich region of the X chromosome and was identified by its proximity to a CpG island. It is thought to be a housekeeping gene. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Dec 2008]
Orthologs
View orthologs and multiple alignments for SLC10A3

Proteins

P3 protein isoform 1 precursor
Refseq ID NP_001135864
Protein GI 215422370
UniProt ID P09131
mRNA ID NM_001142392
Length 477
RefSeq Status REVIEWED
MVLMQDKGSSQQWPGLGGEGGGTGPLSMLRAALLLISLPWGAQGTASTSLSTAGGHTVPPTGGRYLSIGDGSVMEFEFPEDSEGIIVISSQYPGQANRTAPGPMLRVTSLDTEVLTIKNVSAITWGGGGGFVVSIHSGLAGLAPLHIQLVDAHEAPPTLIEERRDFCIKVSPAEDTPATLSADLAHFSENPILYLLLPLIFVNKCSFGCKVELEVLKGLMQSPQPMLLGLLGQFLVMPLYAFLMAKVFMLPKALALGLIITCSSPGGGGSYLFSLLLGGDVTLAISMTFLSTVAATGFLPLSSAIYSRLLSIHETLHVPISKILGTLLFIAIPIAVGVLIKSKLPKFSQLLLQVVKPFSFVLLLGGLFLAYRMGVFILAGIRLPIVLVGITVPLVGLLVGYCLATCLKLPVAQRRTVSIEVGVQNSLLALAMLQLSLRRLQADYASQAPFIVALSGTSEMLALVIGHFIYSSLFPVP
P3 protein isoform 1 precursor
Refseq ID NP_062822
Protein GI 9790143
UniProt ID P09131
mRNA ID NM_019848
Length 477
RefSeq Status REVIEWED
Protein sequence is identical to GI:215422370 (mRNA isoform)
sig_peptide: 1..44 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 4467 peptide sequence: MVLMQDKGSSQQWPGLGGEGGGTGPLSMLRAALLLISLPWGAQG sig_peptide: 1..44 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 4467 peptide sequence: MVLMQDKGSSQQWPGLGGEGGGTGPLSMLRAALLLISLPWGAQG sig_peptide: 1..44 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 4467 peptide sequence: MVLMQDKGSSQQWPGLGGEGGGTGPLSMLRAALLLISLPWGAQG
P3 protein isoform 2 precursor
Refseq ID NP_001135863
Protein GI 215422368
UniProt ID P09131
mRNA ID NM_001142391
Length 448
RefSeq Status REVIEWED
MVLMQDKGSSQQWPGLGGEGGGTGPLSMLRAALLLISLPWGAQGTASTSLSTAGGHTVPPTGGRYLSIGDGSVMEFEFPEDSEGIIVISSQYPGQANRTAPGPMLRVTSLDTEVLTIKNLVDAHEAPPTLIEERRDFCIKVSPAEDTPATLSADLAHFSENPILYLLLPLIFVNKCSFGCKVELEVLKGLMQSPQPMLLGLLGQFLVMPLYAFLMAKVFMLPKALALGLIITCSSPGGGGSYLFSLLLGGDVTLAISMTFLSTVAATGFLPLSSAIYSRLLSIHETLHVPISKILGTLLFIAIPIAVGVLIKSKLPKFSQLLLQVVKPFSFVLLLGGLFLAYRMGVFILAGIRLPIVLVGITVPLVGLLVGYCLATCLKLPVAQRRTVSIEVGVQNSLLALAMLQLSLRRLQADYASQAPFIVALSGTSEMLALVIGHFIYSSLFPVP

Gene Information

Entrez Gene ID
8273
Gene Name
solute carrier family 10, member 3
Gene Symbol
SLC10A3
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0008508 IEA:InterPro F bile acid:sodium symporter activity
GO:0032526 IEA:Ensembl P response to retinoic acid

Domain Information

InterPro Annotations

Accession Description
IPR004710 Bile acid:sodium symporter
IPR002657 Bile acid:sodium symporter/arsenical resistance protein Acr3

UniProt Annotations

Entry Information

Gene Name
solute carrier family 10, member 3
Protein Entry
P3_HUMAN
UniProt ID
P09131
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P09131-1; Sequence=Displayed; Name=2; IsoId=P09131-2; Sequence=VSP_043669; Note=No experimental confirmation available.;
Function The ubiquitous expression and the conservation of the sequence in distant animal species suggest that the gene codes for a protein with housekeeping functions.
Similarity Belongs to the bile acid:sodium symporter (BASS) (TC 2.A.28) family.
Subcellular Location Membrane ; Multi-pass membrane protein .

Identical and Related Proteins

Unique RefSeq proteins for LMP000622 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
215422370 RefSeq NP_001135864 477 P3 protein isoform 1 precursor
215422368 RefSeq NP_001135863 448 P3 protein isoform 2 precursor

Identical Sequences to LMP000622 proteins

Reference Database Accession Length Protein Name
GI:215422368 DBBJ BAI46396.1 448 solute carrier family 10 (sodium/bile acid cotransporter family), member 3, partial [synthetic construct]
GI:215422370 EMBL CAA30998.1 477 unnamed protein product [Homo sapiens]
GI:215422368 EMBL CAL38023.1 448 hypothetical protein, partial [synthetic construct]
GI:215422370 GenBank AAA92651.1 477 P3 [Homo sapiens]
GI:215422368 GenBank AAH04966.1 448 SLC10A3 protein [Homo sapiens]
GI:215422370 GenBank EAW72697.1 477 solute carrier family 10 (sodium/bile acid cotransporter family), member 3, isoform CRA_a [Homo sapiens]
GI:215422368 GenBank EAW72698.1 448 solute carrier family 10 (sodium/bile acid cotransporter family), member 3, isoform CRA_b [Homo sapiens]
GI:215422368 GenBank EAW72699.1 448 solute carrier family 10 (sodium/bile acid cotransporter family), member 3, isoform CRA_b [Homo sapiens]
GI:215422368 GenBank AIC50072.1 448 SLC10A3, partial [synthetic construct]
GI:215422370 RefSeq NP_062822.1 477 P3 protein isoform 1 precursor [Homo sapiens]
GI:215422370 SwissProt P09131.1 477 RecName: Full=P3 protein; AltName: Full=Solute carrier family 10 member 3 [Homo sapiens]

Related Sequences to LMP000622 proteins

Reference Database Accession Length Protein Name
GI:215422368 EMBL CAL38530.1 448 hypothetical protein, partial [synthetic construct]
GI:215422368 GenBank JAA10367.1 448 solute carrier family 10 (sodium/bile acid cotransporter family), member 3 [Pan troglodytes]
GI:215422370 GenBank JAA10368.1 477 solute carrier family 10 (sodium/bile acid cotransporter family), member 3 [Pan troglodytes]
GI:215422368 GenBank JAA13397.1 448 solute carrier family 10 (sodium/bile acid cotransporter family), member 3 [Pan troglodytes]
GI:215422370 GenBank JAA13398.1 477 solute carrier family 10 (sodium/bile acid cotransporter family), member 3 [Pan troglodytes]
GI:215422370 GenBank JAA23344.1 477 solute carrier family 10 (sodium/bile acid cotransporter family), member 3 [Pan troglodytes]
GI:215422368 GenBank JAA33278.1 448 solute carrier family 10 (sodium/bile acid cotransporter family), member 3 [Pan troglodytes]
GI:215422370 RefSeq XP_005277970.1 532 PREDICTED: P3 protein isoform X2 [Homo sapiens]
GI:215422370 RefSeq XP_006724910.1 570 PREDICTED: P3 protein isoform X3 [Homo sapiens]
GI:215422368 RefSeq XP_006724911.1 541 PREDICTED: P3 protein isoform X4 [Homo sapiens]
GI:215422370 RefSeq XP_009438127.1 477 PREDICTED: P3 protein isoform X1 [Pan troglodytes]
GI:215422368 RefSeq XP_009438129.1 448 PREDICTED: P3 protein isoform X3 [Pan troglodytes]